Basic Information

Insect: Incurvaria masculella
Gene Symbol: -
Assembly: GCA_946894085.1
Location: CAMPPJ020000356.1:842174-845394[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.2 16 7.1 0.3 2 23 29 50 28 50 0.94

2 9 1.9e-06 0.00015 22.9 0.4 1 23 56 78 56 78 0.98

3 9 0.0006 0.049 15.0 3.3 1 23 84 106 84 106 0.98

4 9 4.4e-06 0.00036 21.7 1.0 1 23 112 134 112 134 0.98

5 9 0.036 3 9.4 0.7 8 23 158 173 151 173 0.91

6 9 0.00037 0.03 15.7 3.0 1 23 197 219 197 219 0.99

7 9 4.4e-06 0.00036 21.7 1.0 1 23 225 247 225 247 0.98

8 9 0.036 3 9.4 8.3 2 23 262 284 261 284 0.96

9 9 0.00038 0.031 15.6 0.7 1 23 290 313 290 313 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.2	16	7.1	0.3	2	23	29	50	28	50	0.94
2	9	1.9e-06	0.00015	22.9	0.4	1	23	56	78	56	78	0.98
3	9	0.0006	0.049	15.0	3.3	1	23	84	106	84	106	0.98
4	9	4.4e-06	0.00036	21.7	1.0	1	23	112	134	112	134	0.98
5	9	0.036	3	9.4	0.7	8	23	158	173	151	173	0.91
6	9	0.00037	0.03	15.7	3.0	1	23	197	219	197	219	0.99
7	9	4.4e-06	0.00036	21.7	1.0	1	23	225	247	225	247	0.98
8	9	0.036	3	9.4	8.3	2	23	262	284	261	284	0.96
9	9	0.00038	0.031	15.6	0.7	1	23	290	313	290	313	0.96

Sequence Information

Coding Sequence: ATGTTGGCGGTGACTGAATTTCACACATTCCAGGAGGATGTGCTCGAGCACCGCAAGTCGGAGGCGCACCGCAAGCCGCGCGTGCAGTGTCCGCAGTGCCACGTGACCGTCGGCAAGGGCAGCCTGAAGGCGCACGTGACGCGGCTGCACACGGCGCTGCACGAGTACATGTGCGACGTGTGCGGCAAGTCGTTCGGCATGAAGGGCTCTTTCAAACGGCATCTGATGATCCACACGGACGAATTGCCGTTCCGGTGCGAGCGTTGCCCGTACCGCTGCCGCTACCGCGCCTCGCTCACCGAGCACACGCGCGTGCACACGGGCGAGAAGCCGTACGCGTGCGCGCACTGCCCCGCCACCTTCCCCAACGCGAGCAACTTCCGCAAGCACAGCCGCACGCACCAGGCCCACACGCAATACAAGGTGCTGTCCCTCTCCTACACTAGACCGTACGCGTGCGCGCACTGGCCCACCACCTTCCCCAACACGAGCAACTTCCGCAAGCACAGCCGCACGCACCAGGCGCACACGCAGTACAAGGTGCTGTCCCTCTCCTACACTAGAGTGATCCACACGGACGAGCTGCCATTCCAGTGTGAGCGTTGCCCGTACCGCTGCCGCTACCGCGCCTCGCTCACCGAGCACACGCGCGTGCACACGGGCGAGAAGCCGTACGCGTGCGCGCACTGCCCCGCCACCTTCCCCAACGCGAGCAACTTCCGCAAGCACAGCCGCACGCACCAGGCCCACACGCAATACAAGGTGCTGTCCCTCTCCTACACTAGATGCGAGCACTGCCACAAGGGGTTCCACACGATGCACAAGATGAAGGCGCACATCAAGGTGGAGCACATGGGCCTCAAGGAGCACGTGTGCGACCTCTGCGGCAAGGAGTTCGGCTACAAGGAGAAGCTCGGCCAGCACCTGAAGAATGTCCACAAGAGGCCAAAGAAGCGCTCGGGCCGGCTGCCGCTCTACCTCGAGATCGACGAGAAACTGAACCGGCAGCGGAAAATGGAGGAAGCCGAGGAACACCCCCCCTGA
Protein Sequence: MLAVTEFHTFQEDVLEHRKSEAHRKPRVQCPQCHVTVGKGSLKAHVTRLHTALHEYMCDVCGKSFGMKGSFKRHLMIHTDELPFRCERCPYRCRYRASLTEHTRVHTGEKPYACAHCPATFPNASNFRKHSRTHQAHTQYKVLSLSYTRPYACAHWPTTFPNTSNFRKHSRTHQAHTQYKVLSLSYTRVIHTDELPFQCERCPYRCRYRASLTEHTRVHTGEKPYACAHCPATFPNASNFRKHSRTHQAHTQYKVLSLSYTRCEHCHKGFHTMHKMKAHIKVEHMGLKEHVCDLCGKEFGYKEKLGQHLKNVHKRPKKRSGRLPLYLEIDEKLNRQRKMEEAEEHPP

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -