Hrec005578.1
Basic Information
- Insect
- Hyppa rectilinea
- Gene Symbol
- -
- Assembly
- GCA_951799385.1
- Location
- OX637303.1:11886393-11886824[-]
Transcription Factor Domain
- TF Family
- HTH
- Domain
- HTH_psq domain
- PFAM
- PF05225
- TF Group
- Helix-turn-helix
- Description
- This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2.9e-12 1.6e-09 38.3 0.0 3 39 16 52 15 57 0.89 2 2 5.9 3.3e+03 -1.1 0.0 26 35 86 95 84 99 0.84
Sequence Information
- Coding Sequence
- ATGCCTCGAAATTACGTACGAAAGACTGAAACAAAATACCAAATTGAAGATCTGCGCCGTGCAATCGAAGATGTCAGAAGTAAGAAGCTCACACTGGGCAAAGCTGCTACCATATACTCAATACCAAAAACAACAttattcaaacaaataaaacaaaacgaatTCAAGACACCAAAAAAAGTTCGGTACACTGTATTTAATAAAGAACAAGAAGACCAGCGAGAAAAATACATACTTGACTGCTGCAAGTCTTTTTATGGCATAACACCAAGTTCATTACGCAGAATTGCTTTTCGATTTGCTGAAGCtaataaactaaaacataattttaacaaaGAAACCCACCCAGCTGGCTGGCAAGGATTGGTACTATGGCTTTATGTCACGACATCCTTCCATCAGTTTACGCATTCCAGAAGCTACTTCACTTAA
- Protein Sequence
- MPRNYVRKTETKYQIEDLRRAIEDVRSKKLTLGKAATIYSIPKTTLFKQIKQNEFKTPKKVRYTVFNKEQEDQREKYILDCCKSFYGITPSSLRRIAFRFAEANKLKHNFNKETHPAGWQGLVLWLYVTTSFHQFTHSRSYFT
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -