Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 0.0095 0.42 10.7 1.4 3 23 159 179 158 179 0.97

2 6 4e-05 0.0018 18.2 3.1 1 23 183 205 183 205 0.97

3 6 0.078 3.5 7.9 5.8 1 23 210 233 210 233 0.90

4 6 0.00062 0.027 14.5 0.1 2 23 247 269 246 269 0.94

5 6 0.026 1.2 9.4 0.7 1 23 274 296 274 296 0.90

6 6 0.0007 0.031 14.3 0.0 1 23 302 324 302 324 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	0.0095	0.42	10.7	1.4	3	23	159	179	158	179	0.97
2	6	4e-05	0.0018	18.2	3.1	1	23	183	205	183	205	0.97
3	6	0.078	3.5	7.9	5.8	1	23	210	233	210	233	0.90
4	6	0.00062	0.027	14.5	0.1	2	23	247	269	246	269	0.94
5	6	0.026	1.2	9.4	0.7	1	23	274	296	274	296	0.90
6	6	0.0007	0.031	14.3	0.0	1	23	302	324	302	324	0.98

Coding Sequence: atgaacaggcgtgtcgcttaccagcagacccgtgacttgtttgttattttattttgtaaaaaaaaggtacCTAACCAgtcatctttattttttcagCTATCTCCACAAGATGGCCATGATTCAATATGTGCAGTCTGTGTAGCCAGCCTCAAACAATGTGTGACTTTTAAGAAACAAATCCTTAGAAGCATATCCGTGATTTTATCAATTGACTTATCACAAATATTAAGTGAAGAAGACGTGGCAGTTTTAGGATTATTGCAATCAGAGAAAgacattattacaaaatcacAGATTAATGTGAATcaagaaattattaataacaattgtgACGGCTTACATTCGAAGAAATGCGAAGcCCCCTCCCCGCCGTCTTCCCCTAAGacgacaaacaaacacaaacgcCCAGTGGGTCGACCGCGCACACATCCAAAAGATAATATTCCGTATGAAATAAATCGTGAAGAGAGAAATTGCCGGGAGTGCGGTGTACagtttttgaattatttctcaTTAAAGAAACATTACAACACACACTTCCGAAATCACATATGTACAGTGTGCAAGAAGGGTTTCATGACACGAATTAGTCTGATGAAGCACCAAAAGACCCACCAGAAGGGACCTTTTTCTTGTGATATTTGTCATACCcaatttcGCACTTTGAACTCTGTACAAAGCCACAAGCACTTCAAGCACACAGCGCGTTCACGTCGGCTTCCTCCAAACGAGCCTCTACCGTGCCCTTATTGCGACAGAGTTTTTACTTGGTCAGGAGATAGGAATCGTCATATACAAAATCAACATGAAATCCGCATGTACCCTTGCCCGAACTGCGGCATCAAGTTGAAGAAAACGTCTCTCCGTTCACATTTATTCCAACGCCATAATATTGGTACTGGATACAAATGCGCAGTTTGTGACGCTATGAGGGTCACGCGAGCTGCGCTAGCGCGACACATGGACTCCCACTTGGATATAAGAAGGTAA
Protein Sequence: MNRRVAYQQTRDLFVILFCKKKVPNQSSLFFQLSPQDGHDSICAVCVASLKQCVTFKKQILRSISVILSIDLSQILSEEDVAVLGLLQSEKDIITKSQINVNQEIINNNCDGLHSKKCEAPSPPSSPKTTNKHKRPVGRPRTHPKDNIPYEINREERNCRECGVQFLNYFSLKKHYNTHFRNHICTVCKKGFMTRISLMKHQKTHQKGPFSCDICHTQFRTLNSVQSHKHFKHTARSRRLPPNEPLPCPYCDRVFTWSGDRNRHIQNQHEIRMYPCPNCGIKLKKTSLRSHLFQRHNIGTGYKCAVCDAMRVTRAALARHMDSHLDIRR

Sequence clustering based on sequence similarity using MMseqs2