Basic Information

Insect: Hyposmocoma kahamanoa
Gene Symbol: -
Assembly: GCA_003589595.1
Location: NW:125754-127891[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 6e-07 2.6e-05 24.0 3.7 1 23 9 31 9 31 0.99

2 10 0.0013 0.057 13.5 7.6 2 23 38 59 37 59 0.98

3 10 2.4e-06 0.00011 22.1 6.1 1 23 65 87 65 87 0.99

4 10 0.00027 0.012 15.6 2.7 1 23 93 115 93 115 0.98

5 10 2.9e-05 0.0013 18.7 2.2 1 23 121 143 121 143 0.97

6 10 7.5e-05 0.0033 17.4 4.7 1 23 149 171 149 171 0.98

7 10 0.0013 0.058 13.5 4.6 1 23 177 199 177 199 0.94

8 10 0.00042 0.019 15.0 3.5 1 23 205 227 205 227 0.97

9 10 2.2e-05 0.00099 19.0 6.4 1 23 233 255 233 255 0.98

10 10 2.4e-05 0.0011 18.9 5.4 1 23 261 283 261 283 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	6e-07	2.6e-05	24.0	3.7	1	23	9	31	9	31	0.99
2	10	0.0013	0.057	13.5	7.6	2	23	38	59	37	59	0.98
3	10	2.4e-06	0.00011	22.1	6.1	1	23	65	87	65	87	0.99
4	10	0.00027	0.012	15.6	2.7	1	23	93	115	93	115	0.98
5	10	2.9e-05	0.0013	18.7	2.2	1	23	121	143	121	143	0.97
6	10	7.5e-05	0.0033	17.4	4.7	1	23	149	171	149	171	0.98
7	10	0.0013	0.058	13.5	4.6	1	23	177	199	177	199	0.94
8	10	0.00042	0.019	15.0	3.5	1	23	205	227	205	227	0.97
9	10	2.2e-05	0.00099	19.0	6.4	1	23	233	255	233	255	0.98
10	10	2.4e-05	0.0011	18.9	5.4	1	23	261	283	261	283	0.99

Sequence Information

Coding Sequence: ATGATTCATATTGACgagaaaccatacaaatgtcaaatttgcaataaaggttttcggagaaaaTATCACGTTAAGCTTCATATGATGGTCcatactggagagaaaccaAACAAATGTAATCACTGTAACAAATGTTTTGTCAGTAAAGCAGATTGTGAAGCACATTTAAAGACTCATACTGGTGAGAAACCATACAAGTGTGATATTTGCCATAAATGTTTTACAAGAAAGCAGGTACTTAAGACTCATATCATTACtcatactggagagaaaccGTACAAGTGTGACATTTGCTTTAAACGTTTTGGTAGAAAACGTGAACTTGAGTGTCATATAATGATCCATACTGGAGAGAAACCGTACATGTGTGATAtctgcaataaatgttttataagaaaatttcAAGTTATGTATCATATAATGGCTCATACTGGTAAGAAACCGTATGAGTGTGaaatttgcaataaatgttttttaagaaaacatgAACTTGAACGTCATAAGATATCCCATACTGATAAGAAATCATATATGTGTGATATCTGCAATGaatgttttgtaacaaaatatcaACTTCAGTGTCATAAAATGGCACATACTGGTAAGAAACTATATGAGTGTGAAAtctgcaataaatattttataagaaaatatcaATTTAAGTGTCATATAATGGCCCATAATGGGAATAAACCGTATGTGTGTGATATTTGCAAAAAATGTTTCACAGCAAAACATGAACTTAAGCATCATGTAAAGGTCCATACTACAgagaaaccatacaaatgtgaccACTGTAACAAAGCCTTTGCTTCAAAAGGAAATTGTAAAAGGCATTTAAAGATtcatactggagagaaaccaTACATTAAATCAGGTACTTGA
Protein Sequence: MIHIDEKPYKCQICNKGFRRKYHVKLHMMVHTGEKPNKCNHCNKCFVSKADCEAHLKTHTGEKPYKCDICHKCFTRKQVLKTHIITHTGEKPYKCDICFKRFGRKRELECHIMIHTGEKPYMCDICNKCFIRKFQVMYHIMAHTGKKPYECEICNKCFLRKHELERHKISHTDKKSYMCDICNECFVTKYQLQCHKMAHTGKKLYECEICNKYFIRKYQFKCHIMAHNGNKPYVCDICKKCFTAKHELKHHVKVHTTEKPYKCDHCNKAFASKGNCKRHLKIHTGEKPYIKSGT

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -