Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.012 1.3 11.0 0.0 1 20 131 150 131 152 0.95

2 4 7.7e-06 0.00084 21.0 2.0 1 23 235 257 235 257 0.96

3 4 5.4e-07 5.9e-05 24.6 0.9 2 23 264 285 263 285 0.96

4 4 2.2e-05 0.0024 19.6 0.4 1 23 297 319 297 319 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.012	1.3	11.0	0.0	1	20	131	150	131	152	0.95
2	4	7.7e-06	0.00084	21.0	2.0	1	23	235	257	235	257	0.96
3	4	5.4e-07	5.9e-05	24.6	0.9	2	23	264	285	263	285	0.96
4	4	2.2e-05	0.0024	19.6	0.4	1	23	297	319	297	319	0.95

Coding Sequence: ATGGGCGCGGTGAGCCGGCGCGGGCTGGCGCGCGGCCTGCTGTCGCGCCCTTTCGAGCCCGCCGCGGTGGAGCGCACCGTCGGCGACGCGGCCCCCGCCACGGTGCTGGTGGATGTGGACGCGGAGGGCTTCCTGACGGCGCTGGGCGGCGGCGGTGCGGCGCGGCTCACGGCCGCCGCGCGCCTCGCGCCCCACGTGCAGGCCGCTACGCTGCTGCTCACGGCGGCCAGTGATGCGGCCAGTGAGGCAGGCCGTTCGGCCGGGCTGCAGCTGCGAGTTCTGCGCGCCGCGGCGCCGCTGTCCGAGCTGCTGCTCTGGTTCGACGAGCCGCTGCTGGCCGCGCTGCACATACCCTTCCTCACGCTCGATAACATACGAGGGCGGAAAGAGTACGAGTGCGGGGAGTGCGGTGCGCGGTTTGAGGAGCCCAACCCGTTGAAGACGCACCTGTTCCTGCGCTGCGCGCCCGTCACGCCGCCGCGCTTCTGGCGCGCCGTTGCCGCGCGGCTCGCTACCGCCACCGCGGCCGCACCGGCCTCGCCCCCGCTCCACCACACATCCGCCTTCAGGCGCGTGTCGCCGGCCGCAGCCGTGCTGGCGCCGGTCTCTCCGGCGCCGGCGGACGTGAcggaggcggcggcggcggcgtgggCGGCGCGGCTAGAGGCGGCGGCGGCCGAGTGGGGACGCGCGCGCGGCGGCCACGCCTGCCTGTACTGCGGCAAGCTGTACTCGCGCAAGTACGGGCTCAAGATTCACCTGCGCACGCACACGGGCTACCGGCCGCTGCGCTGCCGGCACTGCGGGCGCGCCTTCGGCGACCCCTCCAACCTCAACAAGCACGTGCGGCTGCACGCGGCCGCGGCCTCCGGCTCCGGCGCGCGCCCGCACGCTTGCGCGCGCTGCGGCAAGGCCCTCGCGCGCCGCCGCGACCTCGAGAGGCACATGCGCGCGCACTGTGCGCTGCCGCCGTCCGAGCCCGCGCCCGCGTCCGCGCTCTGA
Protein Sequence: MGAVSRRGLARGLLSRPFEPAAVERTVGDAAPATVLVDVDAEGFLTALGGGGAARLTAAARLAPHVQAATLLLTAASDAASEAGRSAGLQLRVLRAAAPLSELLLWFDEPLLAALHIPFLTLDNIRGRKEYECGECGARFEEPNPLKTHLFLRCAPVTPPRFWRAVAARLATATAAAPASPPLHHTSAFRRVSPAAAVLAPVSPAPADVTEAAAAAWAARLEAAAAEWGRARGGHACLYCGKLYSRKYGLKIHLRTHTGYRPLRCRHCGRAFGDPSNLNKHVRLHAAAASGSGARPHACARCGKALARRRDLERHMRAHCALPPSEPAPASAL

Sequence clustering based on sequence similarity using MMseqs2