Basic Information

Transcription Factor Domain

TF Family: zf-GATA
Domain: zf-GATA domain
PFAM: PF00320
TF Group: Zinc-Coordinating Group
Description: This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.025 59 3.8 0.0 4 17 76 88 74 91 0.77

2 5 0.0063 15 5.7 0.0 4 17 95 107 93 110 0.85

3 5 0.0063 15 5.7 0.0 4 17 114 126 112 129 0.85

4 5 0.0058 14 5.8 0.0 4 17 133 145 131 149 0.85

5 5 0.0034 8.1 6.5 0.2 4 17 152 164 150 179 0.84

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.025	59	3.8	0.0	4	17	76	88	74	91	0.77
2	5	0.0063	15	5.7	0.0	4	17	95	107	93	110	0.85
3	5	0.0063	15	5.7	0.0	4	17	114	126	112	129	0.85
4	5	0.0058	14	5.8	0.0	4	17	133	145	131	149	0.85
5	5	0.0034	8.1	6.5	0.2	4	17	152	164	150	179	0.84

Coding Sequence: atgttcttttatcaaagtcataacaaacatgactacctcggtggcgtagttgttctatggtacgcttgcaataccgaggtctcggattcgaatcccgagtcggacaaagtgatattggatatttcaattcatatgggacagaacatacaaggcgaaatatggatggcgaggcacctctgccttcacctcatgggaaaaggcCCCTCTGTGGCGTTATCAGCCCTCTGTGACGTTACCAGCCCTCTGTGGCGTTACCAGCCATCTGTGGCGTTACCAGCCCTCTGTGGCGTTACCAGCCCTCTGTGGCGTTACCAGCCCTCTGTGGCGTTACCAGCCCTCTGTGGCGTTACCAGCCCTCTGTGGCGTTACCAGCCCTCTGTGGCGTTACCAGCCCTCTGTGGCGTTACCAGCCCTCTGTGGCGTTACCAGCCCTCTGTGGCGTTATCAGCCCTCTGTGGCGTTACCAGCCCTCTgtggcgttactggccttatgtggcattactggccttatgtggcattactggccttacgtggcgttacTAA
Protein Sequence: MFFYQSHNKHDYLGGVVVLWYACNTEVSDSNPESDKVILDISIHMGQNIQGEIWMARHLCLHLMGKGPSVALSALCDVTSPLWRYQPSVALPALCGVTSPLWRYQPSVALPALCGVTSPLWRYQPSVALPALCGVTSPLWRYQPSVALSALCGVTSPLWRYWPYVALLALCGITGLTWRY

Sequence clustering based on sequence similarity using MMseqs2