Hlin023304.1
Basic Information
- Insect
- Hyles lineata
- Gene Symbol
- -
- Assembly
- GCA_030180105.1
- Location
- JARJEE010000038.1:673997-674317[-]
Transcription Factor Domain
- TF Family
- HTH
- Domain
- HTH_psq domain
- PFAM
- PF05225
- TF Group
- Helix-turn-helix
- Description
- This DNA-binding motif is found in four copies in the pipsqueak protein of Drosophila melanogaster [1]. In pipsqueak this domain binds to GAGA sequence [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 3.8e-12 2.2e-09 37.4 0.0 5 38 19 52 18 57 0.89
Sequence Information
- Coding Sequence
- ATGGTACGTACGTACaagaaaaaaactaaaagaGGAGAGTGGTCTACAATTTCTATGAAGACAGCTATAGATAAAGTATTTAGTAAAGAAATGGGCTACAGAAAAGCCGCTTTTGAATACGGAGTGCCTCAGACTACTTTGGAGCGATATGTTAAGAAAATGAAAGAAGATGGTGAAGTTACAATTTCaccattaacaaatatttactacaaaagAAGAAGACGAGATTGTGGCATATCTAAAACATATGGAAGAACGTCTTTTTGGGCTGACAACTCTCGATCTGAGACGTCTAGCATATCAACTGGCTGTGAGAAATGA
- Protein Sequence
- MVRTYKKKTKRGEWSTISMKTAIDKVFSKEMGYRKAAFEYGVPQTTLERYVKKMKEDGEVTISPLTNIYYKRRRRDCGISKTYGRTSFWADNSRSETSSISTGCEK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00332285; iTF_00276208;
- 90% Identity
- -
- 80% Identity
- -