Hsem003200.1
Basic Information
- Insect
- Hipparchia semele
- Gene Symbol
- grn_1
- Assembly
- GCA_933228835.1
- Location
- CAKOGE010000017.1:3600332-3601469[+]
Transcription Factor Domain
- TF Family
- zf-GATA
- Domain
- zf-GATA domain
- PFAM
- PF00320
- TF Group
- Zinc-Coordinating Group
- Description
- This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 2.7 8.9e+03 -3.3 0.1 13 23 15 24 15 24 0.76 2 2 2.5e-20 8.1e-17 60.9 4.7 1 35 42 75 42 76 0.98
Sequence Information
- Coding Sequence
- ATGTTTCTGAATGTGATTTTCTGTCGTCTTCCCCAGCCTGCCAGGAGACAGATAAATAAACCTATCTTATGTTTATTTAGCAATTATTCTGAATCTTATATATCGTACACAGAGGGTCGAGAATGCGTCAACTGCGGGGCGACAAGTACGCCCTTATGGCGGCGCGACGGCACGGGTCACTACCTCTGCAACGCCTGTGGACTCTACTACAAGATGAACGGCCAGAACAGACCCCTCATCAAGCCCAAGCGGAGATTGTCGGGCCAACCAAACCCAGAATGGGTGTTGTTTACAGTTAGGGGCAGTAATAAAAAGGCGGGGCATGCATGCGAGCACGACAGCGCATTAAGCGCTCCCACAAATTGGGCTCTTAAGAAACCTGAGTGTTTCAACGAAAGACCTCTCCGGCCACAAAACTAG
- Protein Sequence
- MFLNVIFCRLPQPARRQINKPILCLFSNYSESYISYTEGRECVNCGATSTPLWRRDGTGHYLCNACGLYYKMNGQNRPLIKPKRRLSGQPNPEWVLFTVRGSNKKAGHACEHDSALSAPTNWALKKPECFNERPLRPQN
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01081209;
- 90% Identity
- -
- 80% Identity
- -