Basic Information

Transcription Factor Domain

TF Family: HSF
Domain: HSF_DNA-bind domain
PFAM: PF00447
TF Group: Helix-turn-helix
Description: Heat shock factor (HSF) is a transcriptional activator of heat shock genes [1, 4]: it binds specifically to heat shock promoter elements, which are palindromic sequences rich with repetitive purine and pyrimidine motifs [1]. Under normal conditions, HSF is a homo-trimeric cytoplasmic protein, but heat shock activation results in relocalisation to the nucleus [2]. Each HSF monomer contains one C-terminal and three N-terminal leucine zipper repeats [3]. Point mutations in these regions result in disruption of cellular localisation, rendering the protein constitutively nuclear [2]. Two sequences flanking the N-terminal zippers fit the consensus of a bi- partite nuclear localisation signal (NLS). Interaction between the N- and C-terminal zippers may result in a structure that masks the NLS sequences: following activation of HSF, these may then be unmasked, resulting in relocalisation of the protein to the nucleus [3]. The DNA-binding component of HSF lies to the N terminus of the first NLS region, and is referred to as the HSF domain.
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 8.7e-27 5.6e-23 81.4 0.0 1 100 12 114 12 114 0.91

2 2 1.5 9.6e+03 -2.7 0.0 36 47 184 195 170 199 0.72

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	8.7e-27	5.6e-23	81.4	0.0	1	100	12	114	12	114	0.91
2	2	1.5	9.6e+03	-2.7	0.0	36	47	184	195	170	199	0.72

Coding Sequence: ATGTACGACGAGTGCGTCATGTTGTCAATGAGGTTTCCGCAAAAATTGTGGAAGATCGTAAACGAGTGTGAAAGCGGCGCCTTAAAGTGGAGCGCCAGCGGTGGTACGATCCTTCTCGATTATAAGAAATTTCAGGATGAATATCTCGGGGCGAAAAAtccaattttcaaaacgagCAATATTACGAGCTTTATTAGACAGCTCAATCTGTATGGTTTTCGCAAAGTAACATCGCATAATCGTGATCCCGTTTGCAATTCCAACAATCCCGACATACACGAGTTTCTTCACGAAAACTTTCGTTCTGGAAGAGCGGACTTGCTTGGGAAAGTTTGCCGAAAAGCCGGCGCCACCGCTAGCGGCAATAAATCAAGAACGTACGAGCGAGATTGCAATTTTAGGAACAACCGATCATCGGCCAACGAGGTTACCGGTAACAAAAGATACGATTCAACAGGACGGTCAAAGCAGATGCACAGAATGACGAGATTACAGATCTGTCAGTACGCTTTGACCAGAGCTCTGGAACAGGCGACGAGGGAatatcatcgtgaaaaaatgctcGCTCAAGTTTTCAAGGACGAGGCTATGATGGAATTGGATAATTTAGAAAATGAAGTTGGAGCGGTGTGGGTGCGACAATACGAGCTAACACCACTGTTGAGAAAGTCgtga
Protein Sequence: MYDECVMLSMRFPQKLWKIVNECESGALKWSASGGTILLDYKKFQDEYLGAKNPIFKTSNITSFIRQLNLYGFRKVTSHNRDPVCNSNNPDIHEFLHENFRSGRADLLGKVCRKAGATASGNKSRTYERDCNFRNNRSSANEVTGNKRYDSTGRSKQMHRMTRLQICQYALTRALEQATREYHREKMLAQVFKDEAMMELDNLENEVGAVWVRQYELTPLLRKS

Sequence clustering based on sequence similarity using MMseqs2