Basic Information

Gene Symbol
Hivep3_1
Assembly
GCA_002150865.1
Location
KZ116773.1:1049-7048[+]

Transcription Factor Domain

TF Family
zf-C2H2
Domain
zf-C2H2 domain
PFAM
PF00096
TF Group
Zinc-Coordinating Group
Description
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 10 0.006 0.42 11.3 1.5 1 23 24 46 24 46 0.99
2 10 0.72 51 4.7 1.7 2 22 51 71 50 73 0.83
3 10 0.00095 0.067 13.8 2.0 1 23 84 106 84 106 0.98
4 10 4.6e-06 0.00033 21.0 0.0 2 23 111 133 110 133 0.96
5 10 8.3e-06 0.00058 20.2 0.8 1 23 140 163 140 163 0.98
6 10 0.0029 0.2 12.3 5.2 3 23 172 192 171 192 0.97
7 10 1.5e-06 0.00011 22.6 0.1 1 23 203 226 203 226 0.95
8 10 3.2e-06 0.00022 21.6 3.8 1 23 232 255 232 255 0.93
9 10 0.001 0.072 13.7 1.6 3 23 266 286 265 286 0.97
10 10 0.0026 0.18 12.4 0.4 2 23 293 315 292 315 0.94

Sequence Information

Coding Sequence
actcgcacttggccggtttatttctTGAGTAGAAGACTAAGACGCGGCTCACAGgtcaataaaaatagttttcagtgTAATATTTGCAAATCCATATTGAGTACAAAGCCCTCGTATTATGAGCATACAAGAAGGCATTTTAGAAGATTGGAGTGCATGGTATGCCATAAGAGGTACAATCATATGCAGTCGGCAGTCCAGCATTATGATGAACAACACGCTCCGGCTGGGGCTGGCATACAGCGAGGGTACACTTGTAAAGAATGTGGCTTTACTACCACATTAAACCGTGCGTACCGCTATCATATGGACAAACACAAGGAGAAGCAGAGCTGCAACATATGTGGGGCTTCCTTCGTCAGTGCTAACGGGCTTAAAGTTCATATGCTCACGGTTCACCAACAATCGTCCCGGGTGTACAAATGCGAGTATTGTAACAAACAGTACAGCGCTCGCTCGGGGTATGAAGCTCATCAGCGCAGTGTGCACGGGGAGCCTGATGATAGAGGGTTCTGTGTTGAGTGTAAGACTCACTTTAGGACGAAGAAAGGATTGGCTCATCATTTGAGTACTCACTCGAGGCATGTTAGTGAGAGTGATAAGAGatttatttgCGACGAATGCGGCGCTAAGTTTGTAACGAAGACTAATTTACAAGTGCACATCAATTgggaacatttaaaaattaacacaCATAAGTGTAGTAAATGCACTAAGGTGTTCAAAAGCCGCTCGGATCTGAATCGTCACGTGACGTACGTACACTTGAAGAAACGTCCGCCGCGCAACAAGATCTGTGACTACTGCGGAAGAGGTTTCACTACGCAAACGATCCTACAATGCCACATCCGCACTCACACAGGCGAGCGTCCACTACAGTGCGCTCAGTGCAGCGCCACCTTCGCACACTCCGCCGCGTTATACACGCATACTAAACTCATACACAAGAGCAGATAG
Protein Sequence
TRTWPVYFLSRRLRRGSQVNKNSFQCNICKSILSTKPSYYEHTRRHFRRLECMVCHKRYNHMQSAVQHYDEQHAPAGAGIQRGYTCKECGFTTTLNRAYRYHMDKHKEKQSCNICGASFVSANGLKVHMLTVHQQSSRVYKCEYCNKQYSARSGYEAHQRSVHGEPDDRGFCVECKTHFRTKKGLAHHLSTHSRHVSESDKRFICDECGAKFVTKTNLQVHINWEHLKINTHKCSKCTKVFKSRSDLNRHVTYVHLKKRPPRNKICDYCGRGFTTQTILQCHIRTHTGERPLQCAQCSATFAHSAALYTHTKLIHKSR

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00111905;
90% Identity
-
80% Identity
-