Basic Information

Insect: Heliconius cydno
Gene Symbol: -
Assembly: GCA_036379175.1
Location: FAPN01001377.1:7499-8623[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 0.18 23 6.7 2.0 1 22 155 176 155 179 0.90

2 7 0.05 6.4 8.5 1.2 2 20 185 202 184 205 0.72

3 7 8.5e-07 0.00011 23.5 0.4 1 23 211 233 211 233 0.98

4 7 5.2e-05 0.0067 17.8 1.6 1 23 239 261 239 261 0.99

5 7 6.2e-07 8e-05 23.9 0.9 1 23 267 289 267 289 0.99

6 7 0.00026 0.033 15.7 1.0 1 23 295 318 295 318 0.96

7 7 4.4e-05 0.0056 18.1 1.6 1 23 324 347 324 347 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	0.18	23	6.7	2.0	1	22	155	176	155	179	0.90
2	7	0.05	6.4	8.5	1.2	2	20	185	202	184	205	0.72
3	7	8.5e-07	0.00011	23.5	0.4	1	23	211	233	211	233	0.98
4	7	5.2e-05	0.0067	17.8	1.6	1	23	239	261	239	261	0.99
5	7	6.2e-07	8e-05	23.9	0.9	1	23	267	289	267	289	0.99
6	7	0.00026	0.033	15.7	1.0	1	23	295	318	295	318	0.96
7	7	4.4e-05	0.0056	18.1	1.6	1	23	324	347	324	347	0.95

Sequence Information

Coding Sequence: atggtAGGACAccttatgttattaaaaatattacactgcAAATTACACAAACGTCGAAAACGattaaacaatgaaaaaaaagattcgCCGTGTTTACCTGAACCTGAAACATCAAcggttaaaaaagaaacaaacgaAATTGATGATCATCAACAAACATGTAGGGTATGTTTAAAAGAAGGTGACATTCCTATTTTCGGTAATGAAGTATCAGAAGATATTTCAGAAACACTTATATCCTTCACTGCCATCGACATTAGCCCCTACGATAACAATCCAAAATTTCTCTGCCGGTCTTGTTACGCTCTTCTTCAAGGTGCtattttactaagaaaaaCTGCACAACAATCCAATATATTGCTACAGCAACCTCACCAAAATATAtcagataatgaaaataatttaaatgcaacagataattttgatacatataatattgaaacatttaaaGAACAAAATGACTACCATTGTAAGAAATGTGCCTTAAGTTTCGAAACATTTAATGAGTACAGTGATCATAGACTTTCAGAGGAACATGAGAATATGAGACAGACTTGtccaatttgtaataaatcctACGCTACACTTTATTTTAAGAGACATTTAGCTTTACACAAAGTAGATACCTCATACATGTGTGATATATGTGGAAAAAAGTTTATAGTGCAAGGGCAATTTGCCAGACACAGGATGACTCACTTTTACAATTTACCTTTCAAATGTTCTGTTTGCCCATATAGAGGTAGATTTAAAGAGTCACTCAAAATGCATATGCGTTCACACACCGGTGAGAAACCATACCAATGTAGTCAATGTCCaggaaaatttgtaaataaaagcaatttaaacaaacatcTGTTAACTCATAAAGGAGATCATGATTTTAAATGTGAGTCCTGTGGTCGAGGGTTTTATACTAAAAGAGACTtggatttacattttaaagtggACCATACAGGCATTAAAGACCATATATGCAGTGAATGTGGCAAAGCATTTGGTTACAGGAAGCAGATGATGAAACATCAACTTAAAGTTCACAAAAGGGAGAAATTAAAGAGTGGTAGAATGCCTTTGTATTTACAATTAGAATGCAAGAAACAACTAGCAATTGAACCAGAATAG
Protein Sequence: MVGHLMLLKILHCKLHKRRKRLNNEKKDSPCLPEPETSTVKKETNEIDDHQQTCRVCLKEGDIPIFGNEVSEDISETLISFTAIDISPYDNNPKFLCRSCYALLQGAILLRKTAQQSNILLQQPHQNISDNENNLNATDNFDTYNIETFKEQNDYHCKKCALSFETFNEYSDHRLSEEHENMRQTCPICNKSYATLYFKRHLALHKVDTSYMCDICGKKFIVQGQFARHRMTHFYNLPFKCSVCPYRGRFKESLKMHMRSHTGEKPYQCSQCPGKFVNKSNLNKHLLTHKGDHDFKCESCGRGFYTKRDLDLHFKVDHTGIKDHICSECGKAFGYRKQMMKHQLKVHKREKLKSGRMPLYLQLECKKQLAIEPE

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00774747;
90% Identity: iTF_00457501;
80% Identity: -