Basic Information

Transcription Factor Domain

TF Family: zf-NF-X1
Domain: zf-NF-X1 domain
PFAM: PF01422
TF Group: Zinc-Coordinating Group
Description: This domain is presumed to be a zinc binding domain. The following pattern describes the zinc finger. C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Two position can be either his or cys. This family includes Swiss:P40798, Swiss:Q12986 and Swiss:P53971. The zinc fingers in Swiss:Q12986 bind to DNA [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.42 5.3e+03 -1.4 1.8 6 10 38 42 36 43 0.49

2 4 2.9e-05 0.36 11.9 9.2 9 18 55 64 53 65 0.92

3 4 0.66 8.2e+03 -2.0 0.8 15 18 91 95 90 96 0.54

4 4 1.7e-09 2.1e-05 25.4 10.2 1 16 101 116 101 117 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.42	5.3e+03	-1.4	1.8	6	10	38	42	36	43	0.49
2	4	2.9e-05	0.36	11.9	9.2	9	18	55	64	53	65	0.92
3	4	0.66	8.2e+03	-2.0	0.8	15	18	91	95	90	96	0.54
4	4	1.7e-09	2.1e-05	25.4	10.2	1	16	101	116	101	117	0.96

Coding Sequence: atgttaaactcATCTACATCAATCTGCACTCCAGGTTTCGAAGAGCTCCGTTGTGAGTGTGGTACTGAGGTCATCCTGCCCCCAGTCCGCTGCGGTACGAAGCCCCCGCCCTGCAGCGCCCcctgccgccgccgccgcgcctgCGACCACCCCCCGCACCACGCGTGCCACTCCGGGGACTGCCCGCCGTGCGTCGTGCTCACCACCAAGCGGTGCTACGGCGACCACGAGGAACGTAAAACAATACCATGTTCTCAAGAGCAGTTTTCATGCGGTCTACCTTGTGGAAAGCCGCTGCCTTGCGGGAAGCATACCTGTATTAAGAAATGTCACACGGGCCCTTGTGATACTGGCAAGTGA
Protein Sequence: MLNSSTSICTPGFEELRCECGTEVILPPVRCGTKPPPCSAPCRRRRACDHPPHHACHSGDCPPCVVLTTKRCYGDHEERKTIPCSQEQFSCGLPCGKPLPCGKHTCIKKCHTGPCDTGK

Sequence clustering based on sequence similarity using MMseqs2