Basic Information

Transcription Factor Domain

TF Family: CG-1
Domain: CG-1 domain
PFAM: PF03859
TF Group: Unclassified Structure
Description: CG-1 domains are highly conserved domains of about 130 amino-acid residues containing a predicted bipartite NLS and named after a partial cDNA clone isolated from parsley encoding a sequence-specific DNA-binding protein [2]. CG-1 domains are associated with CAMTA proteins (for CAlModulin -binding Transcription Activator) that are transcription factors containing a calmodulin -binding domain and ankyrins (ANK) motifs [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 2 2e-12 4.6e-08 34.7 1.8 14 113 8 102 5 105 0.82

2 2 0.28 6.3e+03 -1.3 0.1 88 100 141 152 116 165 0.49

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	2	2e-12	4.6e-08	34.7	1.8	14	113	8	102	5	105	0.82
2	2	0.28	6.3e+03	-1.3	0.1	88	100	141	152	116	165	0.49

Coding Sequence: atgtttcattgtttgtgcttaaaagtggtcgctaacttcacggacccaaCTAAATGTTGTTCTCATCTTCCAGTAAAACCAAAACCTGgggaattttttattatatatagtaaacaCCAGAAAGACTGGAAAGCCGACCAATATCGGTGGAGAAATTTAGGAGTTAAAAATTTGCCAACGCGATCAGAACCTCAGCTTATTTGTCATTATTTTCATTCTATAATGAacaaacaatttcaaaaaagagcttatattatattttgtaataaagacGATAAATATGCTGATTTCACTTTATTACATTACACTGGTTGTTTGCAAGGTGTTAGACCTACGCCTCATGGAAATCGAAAGAAAGAAAAAGACACTGTAAATAGTGAATATATAATGACAGCAAAGTcgcaaattttgaaacaaaagaagaagTTAAATAAAGAACTACATCGGGTTTATAAGAACTTGACAATGGAGAATGTGCATCCAGCGTTATCTTCAGTTTTGCTGCCCAGAGATTATATACAAGTGCGGAAAACTACAACAAAAGAACGGGAAAGAAAACTGTTAACTTCTGATGACATAATTAGGTTATACTTGTTGTAG
Protein Sequence: MFHCLCLKVVANFTDPTKCCSHLPVKPKPGEFFIIYSKHQKDWKADQYRWRNLGVKNLPTRSEPQLICHYFHSIMNKQFQKRAYIIFCNKDDKYADFTLLHYTGCLQGVRPTPHGNRKKEKDTVNSEYIMTAKSQILKQKKKLNKELHRVYKNLTMENVHPALSSVLLPRDYIQVRKTTTKERERKLLTSDDIIRLYLL

Sequence clustering based on sequence similarity using MMseqs2