Basic Information

Gene Symbol
-
Assembly
GCA_000696795.2
Location
NW:46653-81158[-]

Transcription Factor Domain

TF Family
zf-C2H2
Domain
zf-C2H2 domain
PFAM
PF00096
TF Group
Zinc-Coordinating Group
Description
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 14 0.00029 0.011 15.6 0.9 2 23 167 189 166 189 0.97
2 14 0.00084 0.033 14.1 0.5 1 23 195 218 195 218 0.96
3 14 0.00051 0.02 14.8 4.6 1 23 224 247 224 247 0.96
4 14 1.2e-05 0.00049 19.9 1.7 1 23 253 276 253 276 0.97
5 14 0.0063 0.25 11.4 2.5 1 23 282 304 282 304 0.97
6 14 2.3e-05 0.00094 19.0 1.4 1 23 310 333 310 333 0.97
7 14 0.0012 0.046 13.7 2.9 1 23 339 362 339 362 0.97
8 14 3.5e-06 0.00014 21.6 1.7 1 23 368 391 368 391 0.98
9 14 0.0014 0.056 13.4 4.1 1 23 397 419 397 419 0.97
10 14 0.00017 0.0069 16.3 1.1 1 23 425 448 425 448 0.97
11 14 3.3e-05 0.0013 18.5 1.2 2 23 455 477 454 477 0.96
12 14 0.00023 0.0092 15.9 5.7 1 23 483 506 483 506 0.97
13 14 0.0061 0.24 11.4 2.5 1 23 512 535 512 535 0.98
14 14 0.0041 0.16 12.0 8.2 1 23 541 563 541 564 0.96

Sequence Information

Coding Sequence
ATGAATGATATTAAAGAAGAAAGACTACGAGAGTTATATTACgATGAAAGTATTtcaattaaagaagaaatagcTGATGAAACTGAGCCCTGtatttccaTGACTGATATCAAAGAAGAGGAAATTCCAGAAATCTATGACGGTGGAGGCATACATGTGAAACAAGAGGGAGAGTTTATCGTCCCAGAtgatgtttccaCGGCTGATATCAAAGAAGAGGGAATTCCAGAAATCTATGTCGGTGGAGGCATACATGTGAAACAAGAGGGAGAGTTTATCGTCCCAGAtgaagGGGCCTATGATTCCCTGTACCAGCCAAAGGTGGTGAAGCAGTTTCTTTTGGAATCTACTAGTAACAACAATTTGAAGAAAGAATGTGTAATCACTCATTCAGTTTGTAACAAATCTCATAAATGTCCTGCTTGTGAATGTATAGTTGTAGAAGAAAATCATATCAAAGCACATAAAATGAGTGCTCAGGATGGTGAGAAGTCGCAAAAGTGTCCTCATTGCGATTATGGATCAACTCGagttaatgatttgaaaaaccaTATAATGTCCCTTCATACTGGTGAAAGAAATTAtaagtgtcctcattgtgattataaggCAACAGAAGTTGGTTCTTTAAAAAGACATGTAATATCTCTTCATACTGGTGATAGACCTCAtaagtgtcctcattgtgattataaggCAACACAGAGTAGATATTTGAAAAGTCATATAAGGTTTGTTCATATTGGTGAAAGAAATTAtaagtgtcctcattgtgaatacaGAAGTACCCAAACTGGAAATTTGAAGAGGCATATACTGTCCATTCATACTGGTGATAGACCTCATGAGTGTCCgcattgtgattataaagcaACAGAATTTGGTACTTTGAAAACACACATGTCTCTTCATACTGGTGAAAGACCTCACaagtgtcctcattgtgattataaggCAGCACAGAGTGGTGATTTGAAGAGACATATAATGTCCATTCATACTGTTGAGAAGACTCAtaagtgtcctcattgtgattataaagcaACACAAGTTCGTACTTTGAAAACACATATAATGTCCGTTCATACTGGTGAAAGAAATTAtaagtgtcctcattgtgaatacaGTACTACCCAAAGTGGAAATATGAAAAGGCATATAATGTCCATTCATACTGGTGATAGACCTCAtaagtgtcctcattgtgattataaagcaACACAATTTGGTACTTTGAAAACACACATGTCTCTTCATACTGGTGAAANACCTCACaagtgtcctcattgtgattataagaCAGCACAAATTGGTAGtttgaaaatacatattatgtCTGCTCATACTGATGATAAACCTATtaagtgtcctcattgtgattataagaCAATACGTaatgtttatttgaagaaaCATATAATGTCCATTCATACTGGTGAAAGACCTCACaagtgtcctcattgtgattataaagcaACACGTAGTGGTCATTTGAAGAAACATGTTATGTCCAATCATACtggtaaaagaaattataagtgtcctcattgtgattataaagctACATGGattgatcatttaaaaaaacatgtaatgaCCCTTCATAAAGGCGAGAGGAGCCAtaagtgtcctcattgtgaatacaGAACTAACCAAACTGCACATTTGAAAAGTCATATAATGTCCCATCATACTGGTGAGAGGCCTCATTAG
Protein Sequence
MNDIKEERLRELYYDESISIKEEIADETEPCISMTDIKEEEIPEIYDGGGIHVKQEGEFIVPDDVSTADIKEEGIPEIYVGGGIHVKQEGEFIVPDEGAYDSLYQPKVVKQFLLESTSNNNLKKECVITHSVCNKSHKCPACECIVVEENHIKAHKMSAQDGEKSQKCPHCDYGSTRVNDLKNHIMSLHTGERNYKCPHCDYKATEVGSLKRHVISLHTGDRPHKCPHCDYKATQSRYLKSHIRFVHIGERNYKCPHCEYRSTQTGNLKRHILSIHTGDRPHECPHCDYKATEFGTLKTHMSLHTGERPHKCPHCDYKAAQSGDLKRHIMSIHTVEKTHKCPHCDYKATQVRTLKTHIMSVHTGERNYKCPHCEYSTTQSGNMKRHIMSIHTGDRPHKCPHCDYKATQFGTLKTHMSLHTGEXPHKCPHCDYKTAQIGSLKIHIMSAHTDDKPIKCPHCDYKTIRNVYLKKHIMSIHTGERPHKCPHCDYKATRSGHLKKHVMSNHTGKRNYKCPHCDYKATWIDHLKKHVMTLHKGERSHKCPHCEYRTNQTAHLKSHIMSHHTGERPH

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
-
90% Identity
-
80% Identity
-