Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 2.2e-08 1.3e-06 27.7 1.2 2 23 44 65 43 65 0.97

2 6 5.7e-08 3.3e-06 26.4 0.5 3 23 73 93 72 93 0.99

3 6 2.8e-06 0.00016 21.1 2.2 1 23 99 121 99 121 0.98

4 6 3.7e-07 2.1e-05 23.9 0.4 1 23 127 149 127 149 0.95

5 6 0.00017 0.0099 15.5 4.6 2 23 156 177 155 177 0.97

6 6 3.6e-06 0.00021 20.8 1.6 1 23 183 205 183 205 0.99

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	2.2e-08	1.3e-06	27.7	1.2	2	23	44	65	43	65	0.97
2	6	5.7e-08	3.3e-06	26.4	0.5	3	23	73	93	72	93	0.99
3	6	2.8e-06	0.00016	21.1	2.2	1	23	99	121	99	121	0.98
4	6	3.7e-07	2.1e-05	23.9	0.4	1	23	127	149	127	149	0.95
5	6	0.00017	0.0099	15.5	4.6	2	23	156	177	155	177	0.97
6	6	3.6e-06	0.00021	20.8	1.6	1	23	183	205	183	205	0.99

Coding Sequence: ATGTTTCgttgtttgaatttaaaatacgCAGTATGCAGCGTAGTGCAAGAAGCGCCATTAGATTTAAGCTGTCGCGGCGCCGAGGGGAAAATGAATTCGCAAAGTTCagcgaaatttcaaagatgtTTATCTTGCCAGACGTGTGGCAAAAATTTTGACAGACCTTCTTTGCTCAAAAGGCATCTACGAACGCACACAGGTGAAAAGCCACATGGTTGCACTGTGTGTGGAAAAATGTTCAGTACAAGCAGCTCTTTAAACACACATGTCAGAATTCACACTGGAGAACGACCTCACGAATGTCTTATTTGCGGGAAACGTTTCACCGCTTCGTCAAACTTGTACTACCATCGAATGACTCATTACAAGGAAAAACCCCATAAATGCAACGAATGCGGTCGTTCTTTTCCAACCCCCGGTGATTTAAGGGCCCATGGGTATTCCCATAGTGGCAACTGGCCGATGCGATGTTCGGTTTGCAATCGGGGATTTTGCAAACCTGGAGCCCTACATCATCATATGCAATTGCACAtcgGCAATCGACCGTATCGTTGTAATATATgcaagaaacaattttctgtaATCAATAATTTACGATCACACGAGCGATCACACGATCTTGATGTTCCGATTGGAAATATCGCAAACTCTTCAAACCTAGGAAGTGAAACATCAATTATAAACGCAGCTACGTATAAAGATGTAAGTAAAAGTCATTTACAATTTCCAGCTGTTTATTCTTGGTCTTCTTGGATACCATTGCATTATTCAAAGTGA
Protein Sequence: MFRCLNLKYAVCSVVQEAPLDLSCRGAEGKMNSQSSAKFQRCLSCQTCGKNFDRPSLLKRHLRTHTGEKPHGCTVCGKMFSTSSSLNTHVRIHTGERPHECLICGKRFTASSNLYYHRMTHYKEKPHKCNECGRSFPTPGDLRAHGYSHSGNWPMRCSVCNRGFCKPGALHHHMQLHIGNRPYRCNICKKQFSVINNLRSHERSHDLDVPIGNIANSSNLGSETSIINAATYKDVSKSHLQFPAVYSWSSWIPLHYSK

Sequence clustering based on sequence similarity using MMseqs2