Gleg002424.1
Basic Information
- Insect
- Goniozus legneri
- Gene Symbol
- Cebpg
- Assembly
- GCA_003055095.1
- Location
- NCVS01000111.1:91033-91486[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 8.2 5.5e+03 -2.9 0.5 19 23 13 17 4 21 0.48 2 2 6e-15 4e-12 45.6 7.4 2 65 25 88 24 88 0.95
Sequence Information
- Coding Sequence
- atggctccaaaaaataaagaacattCTGcagcaaataataaaaaaaggaaaaatgtaTCCGAAgatgacgacgacgaagacTATAGAAAACGCAGAGACAGAAATAATCAGGCAGTGAAACGCTCAAGAGTTAAAAGTAAATTACGTACTCAACAAACTCTAGAAAGggttaatcaattaaaaacagaaaatgaattattagaagaaaagataaaaatgcTTACAAAAGAATTGGGTTTCCTGAAAGATTTATTTCTTGCGCATGCaggTTCCAGTCAAcattctattaattttcaagatatCGATTTCAATGCCCTACTCTCAGATGATTCCAATGCAAACGAATTGAATAAAGGGAATATCAGAACATAA
- Protein Sequence
- MAPKNKEHSAANNKKRKNVSEDDDDEDYRKRRDRNNQAVKRSRVKSKLRTQQTLERVNQLKTENELLEEKIKMLTKELGFLKDLFLAHAGSSQHSINFQDIDFNALLSDDSNANELNKGNIRT
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00359971;
- 90% Identity
- -
- 80% Identity
- -