Basic Information

Insect: Gonioctena quinquepunctata
Gene Symbol: -
Assembly: GCA_018342105.1
Location: JAFIRS010000143.1:704003-704855[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.00012 0.013 16.9 4.4 1 23 45 67 45 67 0.98

2 8 2.1e-06 0.00024 22.4 2.1 1 23 72 94 72 94 0.98

3 8 1e-05 0.0012 20.3 2.2 1 23 100 122 100 122 0.99

4 8 8.5e-05 0.0099 17.3 6.8 1 23 128 150 128 150 0.98

5 8 0.00016 0.018 16.5 4.4 1 23 156 178 156 178 0.99

6 8 1.1e-06 0.00013 23.2 2.1 1 23 184 206 184 206 0.99

7 8 0.00071 0.082 14.4 0.6 1 23 212 234 212 234 0.97

8 8 3.6e-05 0.0042 18.5 0.3 1 23 240 263 240 263 0.95

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.00012	0.013	16.9	4.4	1	23	45	67	45	67	0.98
2	8	2.1e-06	0.00024	22.4	2.1	1	23	72	94	72	94	0.98
3	8	1e-05	0.0012	20.3	2.2	1	23	100	122	100	122	0.99
4	8	8.5e-05	0.0099	17.3	6.8	1	23	128	150	128	150	0.98
5	8	0.00016	0.018	16.5	4.4	1	23	156	178	156	178	0.99
6	8	1.1e-06	0.00013	23.2	2.1	1	23	184	206	184	206	0.99
7	8	0.00071	0.082	14.4	0.6	1	23	212	234	212	234	0.97
8	8	3.6e-05	0.0042	18.5	0.3	1	23	240	263	240	263	0.95

Sequence Information

Coding Sequence: ATGAAAACTGCACCAAATGAAACATTCTGGAATATCGAAGACATCATAAAGGACGAACCGCTCGAAATTGTCGATCACTCCGTCTTTCTGGAACGGGATATTTCCTTCAAATCTTCTTTCGATGAAAGGCCGTTCAAATGCCAGATTTGTGGAAAAGGATTCATGCATAAATCCTCCAGGAATACACACGAGAAAAAACACTCTGGAGACAAGTACGCTTGCGATGTTTGTCAAAAGTGCTTCGCTACCGCAAAATATTTGAAGGCTCATAAAAACACCCATAAGGATGGAAGACCCTTCAAATGTCGTTATTGTGGCAAAGGCTACAGGAAAAGGGCCAACATGTTGACGCACGAAAGGACACATACAGGTTTCAAGCCACATTCTTGCGATACTTGCGGAAAAAGCTTCACTACTGGGTGCTATCTCAAGTCTCATAAAAGGACTCATACGGATGAGAGACCGTACAAATGTCGTTATTGTGACAAAGATTTTTGTCTAAAGTCCAATAAAACTGCACACGAAAGGATACATACTGGTAACAAACCGTATACCTGCGATATATGCGAGAAAAGCTTCTCCTATAACCAAAATATGAAGGTTCATAAACGGTCccatacaggtgaaaaaccttTCAATTGTCAGTTTTGTGGGCAGGCCTTCGCGCGGGCTTGGTACAAGAAGATACACGAAAAGACTCACAGCGGGAGCAGACAGTTCCTTTGCGAAGTTTGCAACAAGGGGTTCATTTCGAAAGCTGATATGAGTAGTCATATGAATAAAGTTcacaagaaaaaaattcaataa
Protein Sequence: MKTAPNETFWNIEDIIKDEPLEIVDHSVFLERDISFKSSFDERPFKCQICGKGFMHKSSRNTHEKKHSGDKYACDVCQKCFATAKYLKAHKNTHKDGRPFKCRYCGKGYRKRANMLTHERTHTGFKPHSCDTCGKSFTTGCYLKSHKRTHTDERPYKCRYCDKDFCLKSNKTAHERIHTGNKPYTCDICEKSFSYNQNMKVHKRSHTGEKPFNCQFCGQAFARAWYKKIHEKTHSGSRQFLCEVCNKGFISKADMSSHMNKVHKKKIQ

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -