Basic Information

Gene Symbol
Zfa_2
Assembly
GCA_026546565.1
Location
JANSWN010017055.1:4696-6552[-]

Transcription Factor Domain

TF Family
zf-C2H2
Domain
zf-C2H2 domain
PFAM
PF00096
TF Group
Zinc-Coordinating Group
Description
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 14 0.01 0.6 10.9 0.5 1 20 16 35 16 37 0.93
2 14 1.2 67 4.4 1.9 1 23 44 67 44 67 0.92
3 14 3.8e-05 0.0022 18.6 1.9 1 20 73 92 73 95 0.93
4 14 1.9e-05 0.0011 19.5 5.8 1 23 104 127 104 127 0.98
5 14 4.4e-06 0.00025 21.5 2.7 1 23 133 155 133 155 0.97
6 14 0.0021 0.12 13.1 3.2 2 23 165 186 164 186 0.97
7 14 1.6e-06 9.4e-05 22.9 3.3 1 23 192 214 192 214 0.98
8 14 4.1e-07 2.3e-05 24.7 1.4 1 23 220 242 220 242 0.98
9 14 0.00021 0.012 16.2 6.4 1 23 248 270 248 270 0.98
10 14 0.013 0.75 10.6 1.1 1 21 276 296 276 297 0.90
11 14 0.0051 0.29 11.9 0.0 8 23 313 328 308 328 0.93
12 14 0.0014 0.079 13.6 0.1 2 23 336 356 335 356 0.97
13 14 5e-05 0.0029 18.2 3.8 1 23 362 384 362 384 0.94
14 14 0.00066 0.037 14.7 2.7 1 23 390 412 390 412 0.98

Sequence Information

Coding Sequence
ATGCGAATCAATGATGATGATAGGACGATCAAACTGAAACATCCATACCAGTGTAACTACTGCAAGAATACGTTTGATAACATGTTGCTCCTGAACGTTCACAAACAATTGGATTGTGCAAAGAAACCCTACAGCTGTTCCATTTGCATCGATAAAACGTTCACACTAAGAAGAAGTTGGCACTATCACATGATGGGCCACAAGAATGAAATGGCATTCAGCtgcaatgtatgtggcaaagcatttaatcacaggcacggtgtcaaacgacatatgccaattcatTCAAAATACACGCTGAGCACCGAATATCGGTGCAAATTATGCCCGAAAGTGTACCGGCACAGATCGTCGCTGCACACGCACCGAAGGAGTGTACACATGGCAACACATCAATTCATATGCGACATCTGCCAGAAGTCATTTTCTTTAAAACATCTTTTGGCTAAACATATGAAGTATCACGCTAAAAATGCTGCCGTCAAAAAGTTACAATGCCACTACTGTGCACAGCTATTCAATACGAAGTATCGGCTTcgcatacatctgcgttatcacaccggcaaaaacacatacccgtgcaatgtatgccagaagaggtttcccagcgcacacaatttacgaaggcatcagcatgtccactccgacgaaaagctattcacgtgcagcacctgcgataaacgcttcggcacgagctatactcttaatgctcacatgaaaatccatttggcatccaaggagttcaattgtcacatatgctcgaagcagttcaactatcgtagtctgttcgatcaccacatgcgaatccatacgggtgaacaaccatacaagtgtgtatcatgcggaaagtcgttttttaccaagaatggcatgttgggacaccacaaattgtgccaaaatgatgataaacgatcgtttgcgtgtgacgttagcgaaaaaacatttcgacagccggatgacttgaagattcacaaacgtatacacgatggtatacaaataaagatccaatgcaatgtgtgtgaccgtttattaacttcatccgcactggtcatccacatgcgtacccacaccggtgaaaaaccattcgagtgtaaagtttgccataagacattcgctcgacgttactcattaaaattgcacaattttattcattcggatgataaaaaattcgaatgcttcgagtgttcaaatcggttcaaGATATTTTCTAGCTTACGACGGCATATGAAATTGCATGCTCGCGAGCGACATGATTACCTTTAA
Protein Sequence
MRINDDDRTIKLKHPYQCNYCKNTFDNMLLLNVHKQLDCAKKPYSCSICIDKTFTLRRSWHYHMMGHKNEMAFSCNVCGKAFNHRHGVKRHMPIHSKYTLSTEYRCKLCPKVYRHRSSLHTHRRSVHMATHQFICDICQKSFSLKHLLAKHMKYHAKNAAVKKLQCHYCAQLFNTKYRLRIHLRYHTGKNTYPCNVCQKRFPSAHNLRRHQHVHSDEKLFTCSTCDKRFGTSYTLNAHMKIHLASKEFNCHICSKQFNYRSLFDHHMRIHTGEQPYKCVSCGKSFFTKNGMLGHHKLCQNDDKRSFACDVSEKTFRQPDDLKIHKRIHDGIQIKIQCNVCDRLLTSSALVIHMRTHTGEKPFECKVCHKTFARRYSLKLHNFIHSDDKKFECFECSNRFKIFSSLRRHMKLHARERHDYL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
-
90% Identity
-
80% Identity
-