Gbil021645.1
Basic Information
- Insect
- Gnoriste bilineata
- Gene Symbol
- glmp
- Assembly
- GCA_026546565.1
- Location
- JANSWN010011093.1:1-4095[+]
Transcription Factor Domain
- TF Family
- NCU-G1
- Domain
- NCU-G1 domain
- PFAM
- PF15065
- TF Group
- Unclassified Structure
- Description
- NCU-G1 is a set of highly conserved nuclear proteins rich in proline with a molecular weight of approximately 44 kDa. Especially high levels are detected in human prostate, liver and kidney. NCU-G1 is a dual-function family capable of functioning as a transcription factor as well as a nuclear receptor co-activator by stimulating the transcriptional activity of peroxisome proliferator-activated receptor-alpha (PPAR-alpha) [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 4.2e-46 4.3e-42 144.5 0.0 228 352 1 125 1 126 0.97
Sequence Information
- Coding Sequence
- AGCTTCATTCAGTATCGTCCAGTTTCTTATACGCATCCGGAACGAGATGTTTCTACATCGACCGAAATACACATCACAATACCAGGCAATTTAGATAATCCGGTACAACAACTAAATAGTAGTTTGGCATGGGCATACTATGGTTACAGGCTGGATGAGATTCTGGTGCAGGGCTTTAACGTCTCATTCGGACTATCTGGCGATGGTTTCTATGCGAATTCAAATTACAACACTTGGACATTCGTAATGGGCTATGGAGCTCCGCCAAATGAGCAACTTTCGATGTTTGTCGTTATAGTTGCCAGCATCGGTTTGGGTTTGCCACTACTTTTATTAGTTAGTGGCGGATGCTTTATATGCATTAGGCGTGCAAGAAATCGTTAA
- Protein Sequence
- SFIQYRPVSYTHPERDVSTSTEIHITIPGNLDNPVQQLNSSLAWAYYGYRLDEILVQGFNVSFGLSGDGFYANSNYNTWTFVMGYGAPPNEQLSMFVVIVASIGLGLPLLLLVSGGCFICIRRARNR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01265787;
- 90% Identity
- -
- 80% Identity
- -