Basic Information

Insect: Glyphodes pyloalis
Gene Symbol: -
Assembly: GCA_037074685.1
Location: JAYKKO010000003.1:2282942-2284506[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 2.9 2.8e+02 3.2 1.0 2 19 134 151 133 156 0.88

2 7 0.00042 0.041 15.3 1.0 3 23 166 186 165 186 0.97

3 7 0.0021 0.2 13.1 0.2 2 23 228 248 228 248 0.98

4 7 1.9e-05 0.0018 19.5 0.7 1 23 254 277 254 277 0.95

5 7 0.00029 0.028 15.8 2.1 1 23 283 306 283 306 0.97

6 7 7.5e-06 0.00072 20.8 1.6 3 23 314 334 312 334 0.97

7 7 0.00015 0.014 16.7 5.2 1 23 340 362 340 362 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	2.9	2.8e+02	3.2	1.0	2	19	134	151	133	156	0.88
2	7	0.00042	0.041	15.3	1.0	3	23	166	186	165	186	0.97
3	7	0.0021	0.2	13.1	0.2	2	23	228	248	228	248	0.98
4	7	1.9e-05	0.0018	19.5	0.7	1	23	254	277	254	277	0.95
5	7	0.00029	0.028	15.8	2.1	1	23	283	306	283	306	0.97
6	7	7.5e-06	0.00072	20.8	1.6	3	23	314	334	312	334	0.97
7	7	0.00015	0.014	16.7	5.2	1	23	340	362	340	362	0.98

Sequence Information

Coding Sequence: ATGGACTATAAGGCGCAGTGTCGCACGTGCTTGGGCAGCGATAAGGAAATGCGGCACATTCACGCCACTGTCAAAATAACTGGTGAAGACGTGCGATTGTCGGATATTTTGCAAAACTTCTATAGTTACAAGatTTCACCAGAAGATGAATCATTCCCTGAAAACATCTGCATCAACTGTGTTCATCAGCTTACTATCACATATTCATTCAAAGTTTTAATAGAATCAAGTGCCAAAACGTTAGCAGAGCACACGGAGCAAGTCGAGTCAAACAGTGACAATTTCGACTACAATTATGAATCCGATGAAGTAAAGCAAGAACTACGAATAGTGTGCAAAGAAAATAAACGAAAAGTCAAAGTAAGACCGTTATCCATTGAGAACGAACTAAGTATTGTATATTGTGTTGAATGCAAATCTGAATTTCCTTCAGTGAAGGAGCTGACTGAGCATTGTAGCAGCAGCCATCCAGTCAAATCTACGATTGGAAGAGATTGTGAATATTGCAATGAAAAATTTGAAGACTTCCGGTCTCTAGTCCGACACAGGAAGCTGCATTTAAGGCCTTATCTTTGTGAGAATTGCTGGGAGGGTTTCTACGAGGTGACGGATCTGAACTGCCACTCTTGCCAACCTAACATAAATAGTAAAGACAAGAATAAATCTGAGAAAGTGTTACGCCAATGTGATCAGTGTGGCAAGTCGTATCCGCCAGGCTACATTAGAACACACATGTTGACCCACAGCAATGATCGTCCTTACAGTTGCAAATATTGTCCAAAGAGATTCAAAGTGCCCGGTGGCCTTCACTCGCACATCCTCTGGAATCATAAAAGAACAAGAAACCACAAATGTGAGGTGTGCAATGCCACATTCATATCTTCTAGTTCCCGGAGCTCACACATACGAAAGAATCATTTGAAAGAAAAGAAGTATGGCTGTGACAGTTGTGGGAAGAGATTCTTCTCCAAATCTGAATTGCAACGTCACAAATTAACTCATACGGGTGTCAAAAACTTCCATTGTCATTTGTGTGATAAATCATACCAAACTCGTTACGGATTAAATGTGCATTTGAAATCTCATTCACAAATGACTATGAATGTTatgaatttgtaa
Protein Sequence: MDYKAQCRTCLGSDKEMRHIHATVKITGEDVRLSDILQNFYSYKISPEDESFPENICINCVHQLTITYSFKVLIESSAKTLAEHTEQVESNSDNFDYNYESDEVKQELRIVCKENKRKVKVRPLSIENELSIVYCVECKSEFPSVKELTEHCSSSHPVKSTIGRDCEYCNEKFEDFRSLVRHRKLHLRPYLCENCWEGFYEVTDLNCHSCQPNINSKDKNKSEKVLRQCDQCGKSYPPGYIRTHMLTHSNDRPYSCKYCPKRFKVPGGLHSHILWNHKRTRNHKCEVCNATFISSSSRSSHIRKNHLKEKKYGCDSCGKRFFSKSELQRHKLTHTGVKNFHCHLCDKSYQTRYGLNVHLKSHSQMTMNVMNL

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_01125855;
90% Identity: -
80% Identity: -