Gcon032325.1
Basic Information
- Insect
- Glossosoma conforme
- Gene Symbol
- -
- Assembly
- GCA_003347265.1
- Location
- PZYU01072461.1:749-2038[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 8.9 1.9e+04 -3.0 0.0 13 22 10 19 9 25 0.67 2 2 1.9e-14 4.1e-11 44.0 5.6 2 62 30 90 29 92 0.95
Sequence Information
- Coding Sequence
- atgattttgGACGATTTCGCCGAGGGAAGAATGGCACCGAAAAAATCAGGGAAGAAAGAGCTCAGCGACACGGAGGACTATGAAGACGACGAAGACTACAGGAAGAAGAGGGACCGTAATAATCAGGCAGTCAAGCGAAGCCGCTTCAAGTCCAAGCAGAAGACAGCAGAGACCCAGGATCGCATCAACCGGCTCAAAGGCGAGAATGCGGCTCTACAGGACAAGGTCAAAGGGCTCGCCAAGGAGCTCGGTCTGCTCAAGGAGCTTTTTCTCTCGTCGGCCGCTAACGTGCCAAATCCCAAGCTTGATGGAGTCAATCTTGAAGAACTGCTGGCTGCCGATCCAGAAGATACACCTTCCAAGAGTTAA
- Protein Sequence
- MILDDFAEGRMAPKKSGKKELSDTEDYEDDEDYRKKRDRNNQAVKRSRFKSKQKTAETQDRINRLKGENAALQDKVKGLAKELGLLKELFLSSAANVPNPKLDGVNLEELLAADPEDTPSKS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -