Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.72 8.4e+02 1.2 3.0 17 28 109 120 101 143 0.86

2 5 0.02 24 6.2 0.4 19 43 169 190 167 191 0.84

3 5 0.00031 0.36 12.0 2.1 12 39 191 215 180 222 0.77

4 5 0.016 18 6.6 1.1 18 33 225 242 217 250 0.78

5 5 5.5e-06 0.0064 17.6 1.2 11 44 243 276 233 276 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.72	8.4e+02	1.2	3.0	17	28	109	120	101	143	0.86
2	5	0.02	24	6.2	0.4	19	43	169	190	167	191	0.84
3	5	0.00031	0.36	12.0	2.1	12	39	191	215	180	222	0.77
4	5	0.016	18	6.6	1.1	18	33	225	242	217	250	0.78
5	5	5.5e-06	0.0064	17.6	1.2	11	44	243	276	233	276	0.83

Coding Sequence: ATGAGAGCAGGAGATGCGATGCATGCGGGCTTCATACTGATGGTAAGAAGAGAGAATCCCACCCAaacccgcaaccaccgcggcaccgcaccttacgtaccCAAGCTGCGCCTGCGATGCGAGGTACCcccgacgccgttgtacgtatcacACCTGCACTTGGCTATGGAGGTCGAGGACGTCTTGGACTACATCTGCAAGAAGACGTCTCTCGCCTTGAGGATCGAGCGTCTGCCGTCTCGCCATAAGGCCAACTTCACTACAAGTGTTCAGAAAGACGACGAGCGATACTCGGTAACAATAAAAGAAGATGGATCAAAGGATTTTACGTGTAAAGTGTGCCAAAAGGTGTTTAAGAAACAGTGTTTGATTTATCAGCATTACAAGGCAGTTCATTTAAAAATTCGTGCAGGGTTGCGGAGTTGCCATCTCTGTGATGTTTTCGTGGTCAGTCACTTGCGACCATTACATATGGAGGAGGCCCACGGCATACCCAGGCCGGCGTGTAATGCGTGCGGGAAGGTTTTTAACTACCAGTTCAGATTGTTGAGACATCAGAGAACATTCCACATGGGAGAGTTAAACTTCGAGTGCAAATTCTGTGAAAAGAAGTTCTCTGGTAAAAGAAACTTGGATAATCATTTACTCGTTCATCAAAATGAGAGACCTTTTCAATGTACTTTCTgcgaaaaaacatttaaatcaaaaaaatatttagggaTTCACATGAAGATACATTTGAATGATAAAAGATACGAGTGCCGGCTATGCGGCGAGAGATTTGTGCAGACGTCGAGTTTAAAATACCACTTGGGGAAGAGACATCCAGAAGTGCAGTAA
Protein Sequence: MRAGDAMHAGFILMVRRENPTQTRNHRGTAPYVPKLRLRCEVPPTPLYVSHLHLAMEVEDVLDYICKKTSLALRIERLPSRHKANFTTSVQKDDERYSVTIKEDGSKDFTCKVCQKVFKKQCLIYQHYKAVHLKIRAGLRSCHLCDVFVVSHLRPLHMEEAHGIPRPACNACGKVFNYQFRLLRHQRTFHMGELNFECKFCEKKFSGKRNLDNHLLVHQNERPFQCTFCEKTFKSKKYLGIHMKIHLNDKRYECRLCGERFVQTSSLKYHLGKRHPEVQ*

Sequence clustering based on sequence similarity using MMseqs2