Gbue039187.1
Basic Information
- Insect
- Gerris buenoi
- Gene Symbol
- CEBPG
- Assembly
- GCA_001010745.2
- Location
- KZ652879.1:73836-82747[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 4 1e+04 -1.8 0.2 17 25 8 16 5 19 0.56 2 2 2.1e-15 5.2e-12 47.1 8.4 2 65 21 84 20 84 0.96
Sequence Information
- Coding Sequence
- ATGTCTCTGCCGAGCGCCACCAAGAGAGGAAGAAGAAAAACTAAAGACGAAGACAACGATGACGAAGAATATCGgagaaaaagagacaaaaacaACTTGGCCGTAAAGAAGAGCCGAGTCAAGTCGAGGCAGAAGACACAGGAGACGCTCATGAGGGTTCAGCAACTCAAGTCTGAAAACGATCAACTGGAAGAGAAAATCAAACTGCTCAGTAAAGAACTGTGTTTTCTCAAAGATCTGTTCATGGCTCATGCAGgttCAGCGCACGGAATCAATCTGAAAGATGTCGACCTCCAGAAGCTTCTGAATGATCCTGATGATAGTCAGCCTCCGACCAACTACTTGTAA
- Protein Sequence
- MSLPSATKRGRRKTKDEDNDDEEYRRKRDKNNLAVKKSRVKSRQKTQETLMRVQQLKSENDQLEEKIKLLSKELCFLKDLFMAHAGSAHGINLKDVDLQKLLNDPDDSQPPTNYL*
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -