Basic Information

Insect: Gasteruption jaculator
Gene Symbol: -
Assembly: GCA_949825005.1
Location: OX463771.1:8763765-8764724[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.00016 0.018 16.1 3.8 2 23 69 90 68 90 0.96

2 8 0.0089 1 10.6 1.3 3 23 97 118 95 118 0.94

3 8 2.5e-05 0.0029 18.6 3.0 1 23 124 147 124 147 0.96

4 8 0.00041 0.047 14.8 2.0 2 23 154 176 153 176 0.95

5 8 0.00026 0.029 15.4 0.2 1 23 181 203 181 203 0.97

6 8 0.00073 0.083 14.0 0.3 3 23 211 230 210 230 0.97

7 8 1.3e-06 0.00015 22.7 0.3 1 23 236 258 236 258 0.97

8 8 0.00051 0.058 14.5 1.3 1 23 264 286 264 286 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.00016	0.018	16.1	3.8	2	23	69	90	68	90	0.96
2	8	0.0089	1	10.6	1.3	3	23	97	118	95	118	0.94
3	8	2.5e-05	0.0029	18.6	3.0	1	23	124	147	124	147	0.96
4	8	0.00041	0.047	14.8	2.0	2	23	154	176	153	176	0.95
5	8	0.00026	0.029	15.4	0.2	1	23	181	203	181	203	0.97
6	8	0.00073	0.083	14.0	0.3	3	23	211	230	210	230	0.97
7	8	1.3e-06	0.00015	22.7	0.3	1	23	236	258	236	258	0.97
8	8	0.00051	0.058	14.5	1.3	1	23	264	286	264	286	0.97

Sequence Information

Coding Sequence: ATGATGAGAAAGGATTTCAAAGACAACACCGTGACGTTGGTGAAACGTGAATCCCCAATGACTCAAATTCTAGAGCATGGGAATAACCAGAGCATCTTGAAAGAGAACGAAGTCCTACCGAGAAGACCGAGGAGAACTTCAAAAACCGGAACGAgtctaaacaaaaattctgcaaaatgtGGAGAAACAAGGACGGTCCATTTGGAGTGCGACCATTGTAACCGGAAATTCATCAAGAAGAATAACTTGGTGGAGCATCTGATGCATCATTGTGGACTGATATTCGGATGCACTGCTTGCGACTATAAGACCAATAACAAAAGTACCTTAAAAAACCATTTCATCAGATTGCATACCACCAAATTCAGTTACTCTTGTGATATTTGTGggaaacaatttaaaattaagaaGACCCTCAATCATCACGTCAAGCAGAACCACAGCGGAGCACCACCGATAGTGTGTGACGTCTGTGGGcatttcagcaaaaatttgCATGCTCTGAAAGCCCACATGAAATATCGACACTACAAACCGAAGTATGTGTGCAGTATATGCAGTCGAGGAATGACCACGCAGGAAAATTTGAACCAACATTTGACCTGGCACGAGACCAGAGAAAAAGTTCTTTGTCCAACTTGTGGCAAGAGGTTTCGCGGGCGTGACTTGGACTCGCATATGATGGTTCATACCGGGGTCAAGCCGTTCACTTGTCCCGTTTGCGGCAAGACCTTTCGAAGACAAACGGCACAGGAGCAGCATGTCTTGATCCACACTGGAAAGAAACCTTACGTTTGCGACATTTGTGGACACGCATTCGCGCAAAAACCGGGACTGATTTGCCACAGGAAGAGACATCCTGGTCCCTTACCGCCCTTGCCGGCTGTTTCCGTTAAGGGCATCATCACGGAATTCACGAGACAATTCGCTACAGAAAAAAGTGCCATTAAAGCAGAATGA
Protein Sequence: MMRKDFKDNTVTLVKRESPMTQILEHGNNQSILKENEVLPRRPRRTSKTGTSLNKNSAKCGETRTVHLECDHCNRKFIKKNNLVEHLMHHCGLIFGCTACDYKTNNKSTLKNHFIRLHTTKFSYSCDICGKQFKIKKTLNHHVKQNHSGAPPIVCDVCGHFSKNLHALKAHMKYRHYKPKYVCSICSRGMTTQENLNQHLTWHETREKVLCPTCGKRFRGRDLDSHMMVHTGVKPFTCPVCGKTFRRQTAQEQHVLIHTGKKPYVCDICGHAFAQKPGLICHRKRHPGPLPPLPAVSVKGIITEFTRQFATEKSAIKAE

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -