Gpyr006941.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Gandaritis pyraliata
Gene Symbol
-
Assembly
GCA_947859175.1
Location
OX401872.1:80188-81639[+]

Transcription Factor Domain

TF Family
zf-C2H2
Domain
zf-C2H2 domain
PFAM
PF00096
TF Group
Zinc-Coordinating Group
Description
The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 15 0.0087 0.5 11.1 5.9 1 23 81 103 81 103 0.97
2 15 1.5 88 4.1 0.9 10 23 104 117 104 117 0.94
3 15 7.5e-08 4.3e-06 27.1 2.9 1 23 123 145 123 145 0.98
4 15 8.5e-06 0.00049 20.6 1.7 1 23 151 173 151 173 0.99
5 15 2.7e-07 1.6e-05 25.3 3.7 1 23 179 201 179 201 0.97
6 15 1.6e-07 9.5e-06 26.0 4.4 1 23 207 229 207 229 0.98
7 15 1.7e-08 9.7e-07 29.1 3.0 1 23 235 257 235 257 0.97
8 15 2.6e-05 0.0015 19.1 3.5 1 23 263 286 263 286 0.97
9 15 2.6e-09 1.5e-07 31.7 1.5 1 23 292 314 292 314 0.98
10 15 3.4e-06 0.00019 21.9 4.0 1 23 320 342 320 342 0.99
11 15 1.7e-08 9.7e-07 29.1 3.0 1 23 348 370 348 370 0.97
12 15 9.1e-06 0.00053 20.5 4.9 1 23 376 398 376 398 0.99
13 15 1.7e-08 9.7e-07 29.1 3.0 1 23 404 426 404 426 0.97
14 15 3.4e-06 0.00019 21.9 4.0 1 23 432 454 432 454 0.99
15 15 5.5e-08 3.2e-06 27.5 2.3 1 23 460 482 460 482 0.97

Sequence Information

Coding Sequence
ATGCTGTCTCTGGCATCAATACCAACTTTATCGGTTACTCCCACATGGCACATATCTGTTACAAATATTCGTACAACTGTTAAGGAGGAACTAGTTGTAAAAACAGAAGTATCAGCTGAAACAGTCTTTGAAGAGTTACAAGCAACACCTGATGAGGATATCGGTGATTCAAATAATAAAGAACTGCATCTAGAAAACGTAAATGTTGCAGAGAACCCGCCAGCTAACATTCATTTGTGTTTCTGTTGTGATGTGTGCAACAAACGGTTCTTATCCAAATGTCTGTTGATAAGACATATTAAGAACCACTTTAATGacaaaaagagatttacaagacacatgcaaatacacagtggagaaaagccatattcctgcagtagatgtaataaaacatttaaccggagatataatttgacagtacacatgcgaatacacactggagaaaagccatattcctgcagtagatgtaataaaaaattcactcttaaaggtgatgtgacagtacacatgcgaacacacactggagagaagccacattcttgcaatgaatgtaataagacatttgctcagaaaagtgatttaacaaaacataagcgaatacacactggagaaaagccatattcctgcagtagatgtaataaaacattcacacagaaaaatcatttgacagcacacatgcgaatacacactggagagaagccacattcttgcaatgaatgtaataagacatttgctcagaaaagtgatttaacaaaacatatgcgaatacacactggaggaaagctatattcctgcagtagatgtaataaaaaattcactcataaaggtaatgtgacagtacatattatgcgaacacacactggaaagaagccatattcttgcaatgaatgtaataagacatttgctcagaaaagtgatttaacaaaacatatgcgaatacacactggagaaaagccatattcctgcagtagatgtaataaaaaattcactcataaaggtgatgtgacagtacatatgcgaacacacactggagagaagccacattcttgcaatgaatgtaataagacatttgctcagaaaagtgatttaacaaaacatatgcgaatacacactggagaaaagccatattcctgcagtagatgtaataaaaaattcactcataaaggttatgtgacagtacatatgcgaacacacactggagagaagccacattcttgcaatgaatgtaataagacatttgctcagaaaagtgatttaacaaaacatatgcgaatacacactggagaaaagccatattcctgcagtagatgtaataaaaaattcactcataaaggtgatgtgacagtacatatgcgaacacacactggagagaagccacattcttgcaatgaatgtaataagacatttgctcagaaaagtgatttaacaaaacacatgctaatacacacttga
Protein Sequence
MLSLASIPTLSVTPTWHISVTNIRTTVKEELVVKTEVSAETVFEELQATPDEDIGDSNNKELHLENVNVAENPPANIHLCFCCDVCNKRFLSKCLLIRHIKNHFNDKKRFTRHMQIHSGEKPYSCSRCNKTFNRRYNLTVHMRIHTGEKPYSCSRCNKKFTLKGDVTVHMRTHTGEKPHSCNECNKTFAQKSDLTKHKRIHTGEKPYSCSRCNKTFTQKNHLTAHMRIHTGEKPHSCNECNKTFAQKSDLTKHMRIHTGGKLYSCSRCNKKFTHKGNVTVHIMRTHTGKKPYSCNECNKTFAQKSDLTKHMRIHTGEKPYSCSRCNKKFTHKGDVTVHMRTHTGEKPHSCNECNKTFAQKSDLTKHMRIHTGEKPYSCSRCNKKFTHKGYVTVHMRTHTGEKPHSCNECNKTFAQKSDLTKHMRIHTGEKPYSCSRCNKKFTHKGDVTVHMRTHTGEKPHSCNECNKTFAQKSDLTKHMLIHT

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity
iTF_00737673;
90% Identity
-
80% Identity
-