Basic Information

Transcription Factor Domain

TF Family: AP-2
Domain: TF_AP-2 domain
PFAM: PF03299
TF Group: Basic Domians group
Description: Activator protein-2 (AP-2) transcription factors constitute a family of closely related and evolutionarily conserved proteins that bind to the DNA consensus sequence GCCNNNGGC and stimulate target gene transcription [PMID: 2010091, PMID: 1998122]. Four different isoforms of AP-2 have been identified in mammals, termed AP-2 alpha, beta, gamma and delta. Each family member shares a common structure, possessing a proline/glutamine-rich domain in the N-terminal region, which is responsible for transcriptional activation [PMID: 2010091], and a helix-span-helix domain in the C-terminal region, which mediates dimerisation and site-specific DNA binding [PMID: 199812]. http://www.ebi.ac.uk/interpro/entry/IPR013854
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 6.8e-38 2.1e-33 118.2 0.0 81 196 2 116 1 117 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	6.8e-38	2.1e-33	118.2	0.0	81	196	2	116	1	117	0.96

Coding Sequence: ATGTCGTGTTGCGCAGGTGAGGCGATCCACCTGGCCCGAGACTTCGGCTACGTGTGCGAGACGGAGTTCCCCGCCAGACAAGTGGCCGAGTACCTGTGTCGCCAACACACCAACGACCCCACCGAGACCTACCGCCGCAAGGAGCTCATCCACGCTACCAAACAGGTGACGAAGGAGCTGATGGACCTGCTGAACCAGGACCGGTCGCCGCTGTGCAACACGCGGCCGCAGCACATCCTGGAGCCGAGCATCCAGCGGCACCTCACGCACTTCTCGCTCATCTCCCACGGCTTCGGCAGCCCCGCCATCGTGGCCGCCCTCACCGCCATACAGAACTTCCTGTCAGAATCACTGAAGCACCTGGAGAAGGTGTACCCGACAGGgaacagtctgtcggtgacgtCGTCGCAGCAGGGGGGCCCCGGGCTGTCGGACACCAAGCCCAAGGACCTGGGGCCTGACCTGAAGAAGTGA
Protein Sequence: MSCCAGEAIHLARDFGYVCETEFPARQVAEYLCRQHTNDPTETYRRKELIHATKQVTKELMDLLNQDRSPLCNTRPQHILEPSIQRHLTHFSLISHGFGSPAIVAALTAIQNFLSESLKHLEKVYPTGNSLSVTSSQQGGPGLSDTKPKDLGPDLKK

Sequence clustering based on sequence similarity using MMseqs2