Basic Information

Transcription Factor Domain

TF Family: TEA
Domain: TEA domain
PFAM: PF01285
TF Group: Helix-turn-helix
Description: The TEA domain is a DNA-binding region of about 66 to 68 amino acids that has been named after the two proteins that originally defined the domain: TEF-1 and AbaA. The TEA domain is located toward the N terminus of eukaryotic transcription factors of the TEA/ATTS family. It shows a three-helix bundle with a homeodomain fold [3, 1]. Two α-helices are nearly anti-parallel and pack on either side of the third one, which is the DNA-recognition helix of the TEA domain. Phosphorylation of one or both of the two conserved serines found on the DNA-binding surface could interfere with DNA-binding activity, by introducing electrostatic repulsion and/or steric hindrance, and help regulate the transcription factor activity of the proteins [2, 1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 4 0.003 24 6.1 2.2 11 24 34 47 7 85 0.53

2 4 0.0011 8.6 7.6 0.8 11 47 68 94 46 119 0.51

3 4 0.017 1.4e+02 3.7 7.1 36 36 168 168 81 255 0.65

4 4 0.0011 8.9 7.5 0.7 12 45 239 279 220 303 0.59

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	4	0.003	24	6.1	2.2	11	24	34	47	7	85	0.53
2	4	0.0011	8.6	7.6	0.8	11	47	68	94	46	119	0.51
3	4	0.017	1.4e+02	3.7	7.1	36	36	168	168	81	255	0.65
4	4	0.0011	8.9	7.5	0.7	12	45	239	279	220	303	0.59

Coding Sequence: ATGAGTCCACAAAGTTCTGATAATACTGTAGCCGCTGTAACAACAAATAATAAAAATAAAATCAACTTATACATTAGAAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTCCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTCCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTCCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTCATACAAGGAACGTGCTTCTTTTTGCTAA
Protein Sequence: MSPQSSDNTVAAVTTNNKNKINLYIRKERAHTRNVLIQGTCSYKERAHTRNVLIQGTCSYKERAHTRNVLIQGTCSYKERAHTRNVLIQGTCSYKERAHTRNVLIQGTCSYKERAHTRNVLIQGTCSYKERAHTRNVLIQGTCSYKERAHTRNVLIQGTCSYKERAHTRNVLIQGTCSYKERAHTRNVLIQGTCSYKERAHTRNVLIQGTCSYKERAHTRNVLIQGTCSYKERAHTRNVLIQGTCSYKERAHTRNVLIQGTSSYKERAHTRNVLIQGTCSYKERAHTRNVLIQGTCSYKERASFC

Sequence clustering based on sequence similarity using MMseqs2