Basic Information

Insect: Exocentrus adspersus
Gene Symbol: -
Assembly: GCA_029955175.1
Location: JANEYG010000001.1:601192-602004[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.00014 0.0092 17.1 5.8 1 23 23 46 23 46 0.96

2 8 5.5e-06 0.00037 21.5 5.8 1 23 78 100 78 100 0.99

3 8 1.8e-06 0.00012 23.0 3.6 1 23 106 128 106 129 0.95

4 8 0.0023 0.16 13.2 0.3 3 23 137 157 135 157 0.97

5 8 3.5e-06 0.00024 22.1 2.0 1 23 163 185 163 185 0.92

6 8 8.1e-06 0.00055 21.0 1.1 1 20 191 210 191 213 0.93

7 8 0.00012 0.0079 17.3 6.0 1 23 219 241 219 241 0.96

8 8 0.00034 0.023 15.8 1.2 1 23 244 266 244 266 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.00014	0.0092	17.1	5.8	1	23	23	46	23	46	0.96
2	8	5.5e-06	0.00037	21.5	5.8	1	23	78	100	78	100	0.99
3	8	1.8e-06	0.00012	23.0	3.6	1	23	106	128	106	129	0.95
4	8	0.0023	0.16	13.2	0.3	3	23	137	157	135	157	0.97
5	8	3.5e-06	0.00024	22.1	2.0	1	23	163	185	163	185	0.92
6	8	8.1e-06	0.00055	21.0	1.1	1	20	191	210	191	213	0.93
7	8	0.00012	0.0079	17.3	6.0	1	23	219	241	219	241	0.96
8	8	0.00034	0.023	15.8	1.2	1	23	244	266	244	266	0.97

Sequence Information

Coding Sequence: ATGAAAAACGTCCATAATATAAAATCGCAAAAATATAGGAGAAGAAAAAACGAGATTGATGCAACATTCACTTGCCCCACATGTAAAAAGTGTTATACAAGAAAATTCGACATGGAAAAGCACGTTAAAAACAAACATCCTGATCAGAAAAGGGATATGCTTCCGTCAAGTCGAGCAAAAAATATGGGCATCCTCACTCGTTGCAGAATTATAAGTTCTGAAGGAAGTTTCTATAAATGCGATATTTGTGGCCATTCCTTTAAAAAGTCTCACAACTTTGTTAGGCATCGAAATATACACACTAGTGAAAAATCGTTCTTCTGTCACATATGTGGCAAGAAGTTTGTAGTTTCCGGATCTTTAACGCGTCATATCAACCAACATCACTACGGTATAAAAAACTTTGGTTGCACTATCTGCGGAAGGAAATTTAGCGCCAAAGCTACAAGAGACGAACACATGAATATCCACAATAATCTTCGACCCTTTGTTTGCGACGTATGCGGAAAATCATTCAAACAGAATTCCTCTCTGCATATACATAAAGTGTTTCATACGGATAATTTTCCTTTTCCTTGTCAGGTGTGTGATAAAAAGTTTAGGAGAAAAAGAGACCTAACTGTTCACCTCTGGAAACATACCGGTGGAAAGCCTCACCCGTGTAAACAGTGCACCAAGTCTTTTAAACACGAACAGGATTTAAGACGCCATTCAAAAATCCATACTGGGTACTTTTGTGATATCTGTGGCCTTACGTTTCAACAAGAGAGGTTTTTAAAGAACCACTCGAAAATTCATGAAACACCTGAATaa
Protein Sequence: MKNVHNIKSQKYRRRKNEIDATFTCPTCKKCYTRKFDMEKHVKNKHPDQKRDMLPSSRAKNMGILTRCRIISSEGSFYKCDICGHSFKKSHNFVRHRNIHTSEKSFFCHICGKKFVVSGSLTRHINQHHYGIKNFGCTICGRKFSAKATRDEHMNIHNNLRPFVCDVCGKSFKQNSSLHIHKVFHTDNFPFPCQVCDKKFRRKRDLTVHLWKHTGGKPHPCKQCTKSFKHEQDLRRHSKIHTGYFCDICGLTFQQERFLKNHSKIHETPE

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -