Basic Information

Transcription Factor Domain

TF Family: zf-NF-X1
Domain: zf-NF-X1 domain
PFAM: PF01422
TF Group: Zinc-Coordinating Group
Description: This domain is presumed to be a zinc binding domain. The following pattern describes the zinc finger. C-X(1-6)-H-X-C-X3-C(H/C)-X(3-4)-(H/C)-X(1-10)-C Where X can be any amino acid, and numbers in brackets indicate the number of residues. Two position can be either his or cys. This family includes Swiss:P40798, Swiss:Q12986 and Swiss:P53971. The zinc fingers in Swiss:Q12986 bind to DNA [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 6.5e-05 0.9 10.2 6.8 1 12 10 21 10 21 0.94

2 9 0.0073 1e+02 3.7 0.4 3 10 24 31 23 31 0.91

3 9 8.9e-07 0.012 16.2 13.5 3 19 39 55 37 55 0.92

4 9 0.3 4.2e+03 -1.5 0.4 6 10 84 88 83 89 0.73

5 9 0.0026 36 5.1 17.7 1 18 94 110 94 111 0.86

6 9 0.51 7.1e+03 -2.2 0.1 8 11 116 119 115 120 0.77

7 9 1.2 1.7e+04 -3.4 0.9 15 18 137 141 136 141 0.50

8 9 8.7e-09 0.00012 22.6 14.7 1 17 147 165 147 171 0.84

9 9 0.00094 13 6.5 10.4 1 19 177 200 177 200 0.87

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	6.5e-05	0.9	10.2	6.8	1	12	10	21	10	21	0.94
2	9	0.0073	1e+02	3.7	0.4	3	10	24	31	23	31	0.91
3	9	8.9e-07	0.012	16.2	13.5	3	19	39	55	37	55	0.92
4	9	0.3	4.2e+03	-1.5	0.4	6	10	84	88	83	89	0.73
5	9	0.0026	36	5.1	17.7	1	18	94	110	94	111	0.86
6	9	0.51	7.1e+03	-2.2	0.1	8	11	116	119	115	120	0.77
7	9	1.2	1.7e+04	-3.4	0.9	15	18	137	141	136	141	0.50
8	9	8.7e-09	0.00012	22.6	14.7	1	17	147	165	147	171	0.84
9	9	0.00094	13	6.5	10.4	1	19	177	200	177	200	0.87

Coding Sequence: TTATATTACCAACACCAGAAACTGTCCTGCGGTCGTCACCGTTGCCGCAGCGTGTGCTGCGACGCGAGCTCGCACCGCTGCGCGCTCGTGTGCGGGCGCACGCTCTCGTGCCAGCTGCACCGCTGCGAGGACTTCTGTCATACGGGGCACTGTGCACCCTGCCCGCGACTGGACTTCGAAGAGCTCCGTTGCGAGTGCGGGCTGGAAGTGATCCTGCCCCCCGTACGGTGTGGGGCGAAGCCCCCCGCGTGCAACGCCCCGTGCCGGCGCGAGCGGCCTTGCGGCCACCCACCGCACCATACGTGCCACTCGGGCGACTGCCCCCCCTGCGTGGTGCTTACCACCAAGATGTGTCATGGCCGCCATGAGgAACGCAAAACAATACCGTGTTCGCAAGAAGAATTTTCGTGCGGTCTGCCCTGCGCTAAACCGTTGCCGTGCGGGAAACACACGTGCATCAAAACTTGCCATAAAGGACCCTGTGACACAGAGAAATGCAACCAGCCGTGCAACGAGAAGCGCGCTCAGTGCGGGCACCCGTGCGCCGCGGCGTGCCACGCGGCCAACGGCGGCAAGTGCCCCAGCGCCGCGCCCTGCCGCCGCCCCGTGCGCGCCGCCCCCCCCTGCGCGCCCCCCCGCGCC
Protein Sequence: LYYQHQKLSCGRHRCRSVCCDASSHRCALVCGRTLSCQLHRCEDFCHTGHCAPCPRLDFEELRCECGLEVILPPVRCGAKPPACNAPCRRERPCGHPPHHTCHSGDCPPCVVLTTKMCHGRHEERKTIPCSQEEFSCGLPCAKPLPCGKHTCIKTCHKGPCDTEKCNQPCNEKRAQCGHPCAAACHAANGGKCPSAAPCRRPVRAAPPCAPPRA

Sequence clustering based on sequence similarity using MMseqs2