Eman009368.1
Basic Information
- Insect
- Eurema mandarina
- Gene Symbol
- pnr_3
- Assembly
- GCA_018238005.1
- Location
- DWAJ01005031.1:974-7800[-]
Transcription Factor Domain
- TF Family
- zf-GATA
- Domain
- zf-GATA domain
- PFAM
- PF00320
- TF Group
- Zinc-Coordinating Group
- Description
- This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 1.4 3.8e+03 -1.8 0.0 12 19 41 48 39 50 0.79 2 2 2.1e-18 5.7e-15 55.2 3.8 1 35 105 138 105 139 0.97
Sequence Information
- Coding Sequence
- ATGTTCGGCGGCGGCAGCGGTGGCTCGTACAGCGGCGAGTGCGGCGAGGGCTACGGGCTGGGCTACGTGGGCAACGGCCGCCTGCAGCAGTACGCCGCGCACTTCGCGCCGCACCAGAGCTGGCACCACGCGCCGCACCACGCGACCCATCACGACACTTACGGCGGAGGCAGCGTGGCCGGCGTGGGCGGCGTGGGCAGCGGGCTGTACGGCCAGAACATGGTGATGGGCGGCTGGTGCGCGCCCTACGACGCGCTGCAGCGCCCGCCCGCCTATGATGGCGTGCTGGAGGCGTACGAGGAGGGGCGCGAGTGCGTCAACTGCGGTGCCAACAACACGCCGCTGTGGCGGCGCGACGCGACCGGCCACTACCTGTGCAACGCGTGCGGCCTCTACCACAAGATCAACGGCGTGAACCGGCCGCTGGTGAAGCCCAGCAAGCGGCTGGTGAGTAGTGGCTGGCCGAGCTAA
- Protein Sequence
- MFGGGSGGSYSGECGEGYGLGYVGNGRLQQYAAHFAPHQSWHHAPHHATHHDTYGGGSVAGVGGVGSGLYGQNMVMGGWCAPYDALQRPPAYDGVLEAYEEGRECVNCGANNTPLWRRDATGHYLCNACGLYHKINGVNRPLVKPSKRLVSSGWPS
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00149046;
- 90% Identity
- -
- 80% Identity
- -