Eman024975.1
Basic Information
- Insect
- Eurema mandarina
- Gene Symbol
- cnc
- Assembly
- GCA_018238005.1
- Location
- DWAJ01029802.1:1-1875[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 0.78 1.1e+03 0.3 0.0 18 37 25 44 21 60 0.71 2 2 1e-10 1.4e-07 32.0 1.8 3 32 69 98 67 107 0.89
Sequence Information
- Coding Sequence
- ATGTCATGGTGCAAGTGGCGAAGTAATGTGCGGCGGCTCACGGACTGCAGCTCGGAGGGCGGCGCCGGCCACCTCAGCCGCGACGAGAAGCGGGCCAAAGCGCTTGGTATTCCCATGGAAGTCCAAGATATAATAAACCTACCAATGGACGAGTTTAACGAACGTCTCTCGAAGCACGATCTCAGCGAAGCTCAGCTTTCTCTCATACGTGACATCAGACGCAGGGGCAAGAATAAGGTGGCCGCGCAGAACTCCCGCAAGCGCACGCTGGCCCAGATCACGTCGCTCCCGGCCGCGGTGCGCTCGGCACGCGACCGCACGCTGCGC
- Protein Sequence
- MSWCKWRSNVRRLTDCSSEGGAGHLSRDEKRAKALGIPMEVQDIINLPMDEFNERLSKHDLSEAQLSLIRDIRRRGKNKVAAQNSRKRTLAQITSLPAAVRSARDRTLR
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -