Eman017080.1
Basic Information
- Insect
- Eurema mandarina
- Gene Symbol
- CrebA
- Assembly
- GCA_018238005.1
- Location
- DWAJ01013510.1:1-820[+]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 9.7 1.3e+04 -3.2 0.3 38 46 11 19 9 20 0.60 2 2 7.7e-19 1.1e-15 58.0 11.9 2 65 37 100 36 101 0.96
Sequence Information
- Coding Sequence
- AAAGGCTCGACGGGCACGCTGGTCCTGACGGAGGAGGAGAAGCGCACGCTGCTGGCGGAGGGCTACCCCGTCCCCACGCGCCTGCCGCTCACTAAAGCTGAGGAGAAATCTCTTAAGAAGATTAggaggaaaattaaaaataagATATCAGCACAAGAAAGTAGACGCAAGAAAAAGGAGTACATGGACCAATTAGAAAGGAAggtagaaattttattatcagaGAACTCAGATTATAGGAAAAAGGTTGAAACTTTAGAGCAGAAGAATGCGAATCTTATGAGTCAGTTGGCCGCCCTGCAGGCGCTGGTCACGAGGGGAGCTcgcaagtga
- Protein Sequence
- KGSTGTLVLTEEEKRTLLAEGYPVPTRLPLTKAEEKSLKKIRRKIKNKISAQESRRKKKEYMDQLERKVEILLSENSDYRKKVETLEQKNANLMSQLAALQALVTRGARK
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_01139978;
- 90% Identity
- iTF_01139978;
- 80% Identity
- -