Esub024754.1
Basic Information
- Insect
- Eupithecia subumbrata
- Gene Symbol
- -
- Assembly
- GCA_949316285.1
- Location
- OX438647.1:8764665-8765147[+]
Transcription Factor Domain
- TF Family
- zf-GATA
- Domain
- zf-GATA domain
- PFAM
- PF00320
- TF Group
- Zinc-Coordinating Group
- Description
- This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 7 0.00054 1.6 9.3 0.2 4 18 14 28 7 30 0.90 2 7 0.00058 1.7 9.2 0.5 3 15 30 42 29 49 0.85 3 7 0.0015 4.4 7.9 0.1 4 18 65 79 63 81 0.84 4 7 0.00045 1.3 9.6 0.1 4 18 82 96 80 98 0.90 5 7 0.0011 3.3 8.3 0.0 4 15 99 110 97 113 0.88 6 7 0.0013 3.6 8.2 0.2 4 15 116 127 114 130 0.88 7 7 0.0021 6.1 7.5 2.4 4 18 133 147 131 150 0.89
Sequence Information
- Coding Sequence
- ATGTCATCATCGATGACATGCTATGGATGCGGATgcggatgcggcaagctgaagacggcgctGTGGCGCTCAGTGGGGGCTGGATgcgaatgcggcaagctgaagacggcgctGTGGCGGTCAGTGGGGACTAGATgcggatgcggcaagctggagatGGCGCTGTGTCACTCAGTGGGGACTGGTTgcggatgcagcaagctgaagacggcgctGTGGCGCTCAGTGGGGACTGGATgcggatgcggcaagctgaagacggcgctGTGGCGCTCAGTGGGGACTGGATgcggatgcggcaagctgaagacggcgctGTGGCGCTCAGTGGTGACTGGTTgcggatgcggcaagctgaagacggcgctGTGGCGCTCAGTGGTGACTGGTTgcggatgcggcaagctgaagacggcgctGTGGCGCTCAGTGGGGACTGGATgcggatgtggcaagctgactAAAGACTTGAATATGACTTGA
- Protein Sequence
- MSSSMTCYGCGCGCGKLKTALWRSVGAGCECGKLKTALWRSVGTRCGCGKLEMALCHSVGTGCGCSKLKTALWRSVGTGCGCGKLKTALWRSVGTGCGCGKLKTALWRSVVTGCGCGKLKTALWRSVVTGCGCGKLKTALWRSVGTGCGCGKLTKDLNMT
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- -
- 90% Identity
- -
- 80% Identity
- -