Basic Information

Insect: Eupeodes luniger
Gene Symbol: -
Assembly: GCA_951509635.1
Location: OX608074.1:81467343-81468382[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 9 0.00078 0.16 14.0 1.8 6 23 2 19 1 19 0.96

2 9 3.2e-05 0.0064 18.4 2.5 1 23 25 47 25 48 0.96

3 9 6e-07 0.00012 23.8 1.0 2 23 61 82 61 82 0.97

4 9 0.00014 0.027 16.4 0.4 2 23 88 109 87 109 0.97

5 9 9.5e-07 0.00019 23.2 1.8 1 23 115 137 115 137 0.96

6 9 1.8e-05 0.0036 19.2 3.2 1 21 143 163 143 165 0.94

7 9 2.6e-07 5.3e-05 25.0 0.8 1 23 171 193 171 193 0.96

8 9 7.2e-07 0.00014 23.6 3.0 1 23 199 221 199 221 0.99

9 9 2.3e-05 0.0045 18.9 0.2 1 23 226 249 226 249 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	9	0.00078	0.16	14.0	1.8	6	23	2	19	1	19	0.96
2	9	3.2e-05	0.0064	18.4	2.5	1	23	25	47	25	48	0.96
3	9	6e-07	0.00012	23.8	1.0	2	23	61	82	61	82	0.97
4	9	0.00014	0.027	16.4	0.4	2	23	88	109	87	109	0.97
5	9	9.5e-07	0.00019	23.2	1.8	1	23	115	137	115	137	0.96
6	9	1.8e-05	0.0036	19.2	3.2	1	21	143	163	143	165	0.94
7	9	2.6e-07	5.3e-05	25.0	0.8	1	23	171	193	171	193	0.96
8	9	7.2e-07	0.00014	23.6	3.0	1	23	199	221	199	221	0.99
9	9	2.3e-05	0.0045	18.9	0.2	1	23	226	249	226	249	0.90

Sequence Information

Coding Sequence: ATGTGTGAGATGCGATTTAATAGGGCTGATCATTTGAAAAACCACATGACAAAACATAACCCCGTTAAGCCATTCCAATGTGATAGCTGTGGTGCGAGTTATGGTCGTGCGGATCATCTAAAACGTCACAAAGAAATGCACCATTCAAATGATCCAAATAGTGCTCCAGTAAAGGGGGAAGTTTGCGAATATTGTAATAAGTCATACAGTTCTAAAGCCTATTTACAAAAGCATTTGTTAAAGCACACGGAAAAATGTTGGAAATGCAAATTGTGTTCCGTTGTGTTTGAAACTAATGAAGCCCTCAAGGAACACAGCAAGACCCACAGCAAAGATAAACCGTTTCTCTGTTCAGAATGCGGTTTATGTTTTCCAAGGAAGAATTATCTCATCATTCATATGCGAAGGCACAATGGTGAACGCCCGTATAAATGCCAATACTGCGATAAGGGTTTTCCACGTTCTACTGACTTAAAAGCACATGAAAAATGTCACACGGGAGAGAAAACACACTTTTGTAACGTCTGTGGTAAAGGCTTCCCGCGACCGTACAAACTGTCTGTACATATGCGAATTCATACCGGCGAAAAACCCTATCAATGCATGCACTGTCCAAAGGCCTTCGCACAGTGTAATGATTTGAAGGCACATATTCGACGGCACACTGGAGAGCGATTTAGATGTGAATTATGTGGAGCTggattcatacaaaaatacaatttgacCCAACACAAGGCAGATGCCCATGGCATTATAAATCAGTCTCGTTTAGGTCGAGTGGCTAAAATACCTATTGCTGAGCCAATTGGAGAGACGATGACCTCAGTTATTAATGATTCTGATGAAAAATTACAAATGGGACTTTCAACAAATTTACTATTTCGTGGTGTGGCACTTCATTAA
Protein Sequence: MCEMRFNRADHLKNHMTKHNPVKPFQCDSCGASYGRADHLKRHKEMHHSNDPNSAPVKGEVCEYCNKSYSSKAYLQKHLLKHTEKCWKCKLCSVVFETNEALKEHSKTHSKDKPFLCSECGLCFPRKNYLIIHMRRHNGERPYKCQYCDKGFPRSTDLKAHEKCHTGEKTHFCNVCGKGFPRPYKLSVHMRIHTGEKPYQCMHCPKAFAQCNDLKAHIRRHTGERFRCELCGAGFIQKYNLTQHKADAHGIINQSRLGRVAKIPIAEPIGETMTSVINDSDEKLQMGLSTNLLFRGVALH

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00665066;
90% Identity: iTF_01318437;
80% Identity: -