Basic Information

Insect: Eupelmus annulatus
Gene Symbol: ZNF219
Assembly: GCA_900480025.1
Location: UDEW01005256.1:4553-5452[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 7 1.9e-05 0.0017 19.1 1.7 2 23 101 122 100 122 0.97

2 7 5.3e-05 0.0047 17.7 3.5 1 23 128 151 128 151 0.97

3 7 4.8e-05 0.0042 17.9 1.6 1 23 157 179 157 179 0.96

4 7 3.7e-06 0.00033 21.4 0.8 1 23 185 207 185 207 0.97

5 7 0.0069 0.61 11.1 3.1 1 23 213 235 213 235 0.98

6 7 8.2e-07 7.2e-05 23.4 1.0 1 23 241 263 241 263 0.97

7 7 1.5e-05 0.0013 19.4 2.5 1 23 269 292 269 292 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	7	1.9e-05	0.0017	19.1	1.7	2	23	101	122	100	122	0.97
2	7	5.3e-05	0.0047	17.7	3.5	1	23	128	151	128	151	0.97
3	7	4.8e-05	0.0042	17.9	1.6	1	23	157	179	157	179	0.96
4	7	3.7e-06	0.00033	21.4	0.8	1	23	185	207	185	207	0.97
5	7	0.0069	0.61	11.1	3.1	1	23	213	235	213	235	0.98
6	7	8.2e-07	7.2e-05	23.4	1.0	1	23	241	263	241	263	0.97
7	7	1.5e-05	0.0013	19.4	2.5	1	23	269	292	269	292	0.98

Sequence Information

Coding Sequence: ATGAAAAGGAGAGGAGGCCGCGTGgtcaagaaaaaaagtctcAAGAAATCCAGCAAAGTGAAGATCAAATCCGAAAGTCCCAAACAATCCTTAGAAGACCCAGAAATCTCCGCTCTTTCCACAGTCAAAGTTGAATCCACAACCACAGCTATGGACCAAGACGTCGACGACGAAGACGACATCCCCGAGAACAACGATGACGCCAACGACGAAGACTACGAGGTGCCGGTGTCCCCTGAATCTgctaaagcaaaaaaatcacGCAAGAGAAGCAGCAATGCGCCAGCAATGGGCAATCTAGAGTGCACGCAGTGCAATAAGAAGTTCCGCATGTACAATAGCTACCAAATCCACATGAGGGTCCACACCGGCGAGAAGCCCTACACCTGCCACATCTGCGGCAAGCAGTTCGGACAGACGGGTAGTCTTTACTATCATCTGAGGCATGTGCACGGCGGCGTTAAGAATCATGCTTGCGACATTTGCGGACGTTGCTTCGCTATGAAGACGGCCATGGAGGATCATCGACGTATTCACACTGGCGAGCGACCATACATCTGCGACTCCTGCGGCAAGACCTTCAAAACGAAAGCCTCGCTCTACATTCACAGCAAAATCCATACCAACGAGTATCCGTTCAAGTGCAGCTACTGCAAGAAGCTCTTTAGATGGAAGCAGCAGATGATCAGCCACTTGACGACCCACACTGGCGAGAAGAATCACATCTGCGACATTTGCGGAAAAGGATTCGGTGTGAAGAACGAACTGACTAGGCATCGACGTACCCACTCGTCCGACAAACCTTTCACCTGCCAGAAGTGCGGAGTGAGCTTTGGACAGAAGCGTTATCTGACCAACCATAACAGGACGCGACACAAGACCAAAGCTACCGACAATTAA
Protein Sequence: MKRRGGRVVKKKSLKKSSKVKIKSESPKQSLEDPEISALSTVKVESTTTAMDQDVDDEDDIPENNDDANDEDYEVPVSPESAKAKKSRKRSSNAPAMGNLECTQCNKKFRMYNSYQIHMRVHTGEKPYTCHICGKQFGQTGSLYYHLRHVHGGVKNHACDICGRCFAMKTAMEDHRRIHTGERPYICDSCGKTFKTKASLYIHSKIHTNEYPFKCSYCKKLFRWKQQMISHLTTHTGEKNHICDICGKGFGVKNELTRHRRTHSSDKPFTCQKCGVSFGQKRYLTNHNRTRHKTKATDN

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00692356;
90% Identity: iTF_00691407;
80% Identity: iTF_00691407;