Basic Information

Insect: Eumaeus atala
Gene Symbol: -
Assembly: GCA_017140195.1
Location: JAOYMN010052385.1:1-10166[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.00011 0.0096 16.7 0.2 1 23 178 201 178 201 0.94

2 10 0.0038 0.34 11.8 0.3 2 23 227 249 226 249 0.94

3 10 0.0046 0.41 11.6 1.6 1 23 272 294 272 294 0.97

4 10 1.3e-06 0.00011 22.7 1.5 1 23 298 320 298 320 0.98

5 10 0.00041 0.036 14.9 4.0 1 23 325 348 325 348 0.97

6 10 0.0012 0.11 13.4 0.5 3 23 357 378 355 378 0.93

7 10 2.8e-06 0.00024 21.7 1.1 1 23 384 407 384 407 0.98

8 10 7.1e-06 0.00062 20.4 3.1 2 23 414 435 413 435 0.96

9 10 2.9e-07 2.6e-05 24.8 2.0 1 23 441 463 441 463 0.99

10 10 6.7e-05 0.0059 17.3 4.5 1 23 469 491 469 492 0.96

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.00011	0.0096	16.7	0.2	1	23	178	201	178	201	0.94
2	10	0.0038	0.34	11.8	0.3	2	23	227	249	226	249	0.94
3	10	0.0046	0.41	11.6	1.6	1	23	272	294	272	294	0.97
4	10	1.3e-06	0.00011	22.7	1.5	1	23	298	320	298	320	0.98
5	10	0.00041	0.036	14.9	4.0	1	23	325	348	325	348	0.97
6	10	0.0012	0.11	13.4	0.5	3	23	357	378	355	378	0.93
7	10	2.8e-06	0.00024	21.7	1.1	1	23	384	407	384	407	0.98
8	10	7.1e-06	0.00062	20.4	3.1	2	23	414	435	413	435	0.96
9	10	2.9e-07	2.6e-05	24.8	2.0	1	23	441	463	441	463	0.99
10	10	6.7e-05	0.0059	17.3	4.5	1	23	469	491	469	492	0.96

Sequence Information

Coding Sequence: TTAAATGAAAAACGTGAATGCTCCAGCATATGCGAAACATGTATAAAAATTCTACGGGAAAGTCTTCATTTTAAACATCAAGTTCTCAATTCAGAACAAGAGCTGTCAAGGAATGTTGAAAATTTGTTAAATGTTGATGACAAAACTCAGATTAAAATTGAACCTAAGTTTGAAAGTGACGACAACGAATCTGATGACTATTTCTTGGCCGACGCAGTTTCAGTTAAAGAAGAATATGAACCAATTAAAAAAAGAACAGAACATAAGAAGAAAAAGACGAAAAAAATAGACGATTGGAGTCCAAAGAAGTTAAAAACCTTAGTGAAAAGGATCTCATTGAAATCCCGGGACTTGACAATAAAGCAGAAAAAAATAAAAAACGACAGTACAATTACAATAGGCAGTGATCTTAAACTGAATGTGTCTTGGACGTCCCGTGTAAACCACGAAAAGAAGAAGCACAAGGAGAACTTGCAGACAGTGTtgaaatattcaaacgtcactccgttcaaaaacaaatcattgttggggtacatgtgcgggtactgcgacaaaaagtaccccgacccagtagacctgcggtatcacacggaaaacgaccacaaaaaagaaagagtagaatttagatcgtcttttgacatgactgaatacaacgttaaactagacgtgactgatctaaaatgtacgttatgtaatgaaaaaataactaatttgacaaatttgaccgaacatttagtgagggtacatgaaaaaccttatcacgtggatatcaaagatcacctaatgcaatttaaactgaagaaaggcgatatatacgattgcgctatgtgctcatcgacgtatgagacgttcaaaatgttgaaacaacatatgaataagcattacagtaattacagctgcagtaaatgcgatacttcgtttgcaaccaaacgctcgttgaattcgcaccaagcgacgcacttggagggtagtttcaaatgcgaccagtgcgataaagtgttctctagtaaaaataaaaaacaataccatgaaaagacaaaacatttaggtgctaggaacattagcaattgtccatactgcaacgaacccttccgtagttattatcagcgaaatcagcatttagttaaggtccatgattccgaagctcagtataagtgtaatgtgtgcgacaagagttacattttaaagtctctattgatgtctcatattaaaaagaatcacttgatggagaggaattgtcaatgtacagaatgcgggtacaggttttttagtaaaaaagcattgaaggctcatatgattaaacacagcggggagagaaagtacacttgcgaagtgtgtcacaaagcgtacgcgcggaagtacacactgagggaacacatgcgaatacataacaacgatagacggttcaagtgtgacgtctgcaatacagcattcgttcagaagtgtagccttaagagtcatttgctgtctcaccatggaattagtttgGCAGCGAGTGATATAACCTCAGTATAA
Protein Sequence: LNEKRECSSICETCIKILRESLHFKHQVLNSEQELSRNVENLLNVDDKTQIKIEPKFESDDNESDDYFLADAVSVKEEYEPIKKRTEHKKKKTKKIDDWSPKKLKTLVKRISLKSRDLTIKQKKIKNDSTITIGSDLKLNVSWTSRVNHEKKKHKENLQTVLKYSNVTPFKNKSLLGYMCGYCDKKYPDPVDLRYHTENDHKKERVEFRSSFDMTEYNVKLDVTDLKCTLCNEKITNLTNLTEHLVRVHEKPYHVDIKDHLMQFKLKKGDIYDCAMCSSTYETFKMLKQHMNKHYSNYSCSKCDTSFATKRSLNSHQATHLEGSFKCDQCDKVFSSKNKKQYHEKTKHLGARNISNCPYCNEPFRSYYQRNQHLVKVHDSEAQYKCNVCDKSYILKSLLMSHIKKNHLMERNCQCTECGYRFFSKKALKAHMIKHSGERKYTCEVCHKAYARKYTLREHMRIHNNDRRFKCDVCNTAFVQKCSLKSHLLSHHGISLAASDITSV

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00262068;
90% Identity: iTF_00262068;
80% Identity: -