Basic Information

Insect: Eucriotettix oculatus
Gene Symbol: -
Assembly: GCA_034510155.1
Location: CM067376.1:4175842-4176756[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 1.5e-09 1.6e-07 32.7 2.2 1 23 8 30 8 30 0.99

2 10 1.2e-08 1.2e-06 29.9 1.0 1 23 36 58 36 58 0.99

3 10 5.5e-07 5.7e-05 24.6 2.4 1 23 64 86 64 86 0.98

4 10 2.6e-06 0.00027 22.5 2.4 1 23 92 114 92 114 0.98

5 10 1.1e-07 1.1e-05 26.9 0.2 1 23 120 142 120 142 0.99

6 10 2e-05 0.002 19.7 2.5 1 23 148 170 148 170 0.97

7 10 2e-08 2e-06 29.2 3.1 1 23 176 198 176 198 0.99

8 10 1.5e-06 0.00016 23.2 1.8 1 23 204 226 204 226 0.97

9 10 0.00015 0.015 17.0 5.7 1 23 232 254 232 254 0.97

10 10 1e-06 0.0001 23.8 0.4 1 23 260 282 260 282 0.98

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	1.5e-09	1.6e-07	32.7	2.2	1	23	8	30	8	30	0.99
2	10	1.2e-08	1.2e-06	29.9	1.0	1	23	36	58	36	58	0.99
3	10	5.5e-07	5.7e-05	24.6	2.4	1	23	64	86	64	86	0.98
4	10	2.6e-06	0.00027	22.5	2.4	1	23	92	114	92	114	0.98
5	10	1.1e-07	1.1e-05	26.9	0.2	1	23	120	142	120	142	0.99
6	10	2e-05	0.002	19.7	2.5	1	23	148	170	148	170	0.97
7	10	2e-08	2e-06	29.2	3.1	1	23	176	198	176	198	0.99
8	10	1.5e-06	0.00016	23.2	1.8	1	23	204	226	204	226	0.97
9	10	0.00015	0.015	17.0	5.7	1	23	232	254	232	254	0.97
10	10	1e-06	0.0001	23.8	0.4	1	23	260	282	260	282	0.98

Sequence Information

Coding Sequence: ATGTACGCTGGTGAGAAACTATACAAATGTGCagaatgtgataaaacattttcacaatcctCCCACTTAACAGCTCATAtaaggactcacactggtgaaaagccatacaaatgtgtagagtgtgataaGACATTCTCACAATCTGGCAGTTTAACAACACACATGATGACTCACACTGGTgtaaagccatacaaatgtgttgaatgtgataaatcaTTCATAAAATCTTCACACTTAAGAACCCATATTTATATTCACACTGGAGAAAAGCCATACAAGTGTATCGAGTGTCATAAATCATTCTCAGGATCCTCTACCTTAAGAGTACACATAAGGAcacacactggtgaaaaaccatacacaTGTGTCGAATGTGACACATCTTTTGCTCAGTCAGCTGACCTAACAAATCATATGAGAATTCATACACAAGAAAAGCCATTCCATTGTGCAGCCTGTGGAAAAACATTTGCACGTTGCAGTGTCCTAAAAAtccacatgagaattcacactggagaaaaaccattcaaatgtgttgagtgtaataaaacattctcaaaatCCTCCAGCTTAACTAAGCACATGAGGagtcacactggtgaaaaaccatacaaatgtattCTGTGTGATAAACGATTTTCACGTAACAGCTATCTAACGGTCCACATGAGTACTCACACAGGCAAAAAACCATTCAAGTGTATCAATTGCCATAAGACATTCTCACATAACATCAAACTAATAGaccacatgaggactcacactggtaaAAAGCCATACAATTGTCTCGAGTGTTTTGCCTCTTTCCCTCGGTCATCAGCCCTAACaagacacatgagaattcacactggagaAAAACCATTGCAGTGTATGGAGAAACACTTATACAACCTGGTCACTTCAGATTTCACATGA
Protein Sequence: MYAGEKLYKCAECDKTFSQSSHLTAHIRTHTGEKPYKCVECDKTFSQSGSLTTHMMTHTGVKPYKCVECDKSFIKSSHLRTHIYIHTGEKPYKCIECHKSFSGSSTLRVHIRTHTGEKPYTCVECDTSFAQSADLTNHMRIHTQEKPFHCAACGKTFARCSVLKIHMRIHTGEKPFKCVECNKTFSKSSSLTKHMRSHTGEKPYKCILCDKRFSRNSYLTVHMSTHTGKKPFKCINCHKTFSHNIKLIDHMRTHTGKKPYNCLECFASFPRSSALTRHMRIHTGEKPLQCMEKHLYNLVTSDFT

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -