Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 8 0.2 2.3e+02 3.2 0.3 19 41 10 29 6 31 0.84

2 8 0.052 58 5.1 0.4 18 41 37 57 29 59 0.79

3 8 0.0039 4.3 8.7 0.4 18 41 65 85 61 87 0.89

4 8 0.012 14 7.1 1.0 18 41 93 113 86 115 0.82

5 8 0.00036 0.4 12.0 1.0 17 41 120 141 114 143 0.88

6 8 0.037 41 5.6 0.8 18 41 149 169 142 171 0.75

7 8 0.0012 1.3 10.4 1.6 15 40 174 196 166 199 0.84

8 8 0.017 19 6.7 0.2 17 40 204 224 197 229 0.83

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	8	0.2	2.3e+02	3.2	0.3	19	41	10	29	6	31	0.84
2	8	0.052	58	5.1	0.4	18	41	37	57	29	59	0.79
3	8	0.0039	4.3	8.7	0.4	18	41	65	85	61	87	0.89
4	8	0.012	14	7.1	1.0	18	41	93	113	86	115	0.82
5	8	0.00036	0.4	12.0	1.0	17	41	120	141	114	143	0.88
6	8	0.037	41	5.6	0.8	18	41	149	169	142	171	0.75
7	8	0.0012	1.3	10.4	1.6	15	40	174	196	166	199	0.84
8	8	0.017	19	6.7	0.2	17	40	204	224	197	229	0.83

Coding Sequence: ATGTACACTTACGGAAAACCTTACAactgtgttgagtgtgataaaacattttcacaactCTCAAGCTTAACATaccacatgaggactcacactggtgagaaaccatacaaatgtgtggACTGTGATGAAGTATTCTCACTTTCCTCAACCTTAACAAagcacatgaggactcacactggtgaaagaCCATACAAATGCAGCGAGTGTgataaaacgttttcacaatCATCAAACTTAACATttcacatgaggactcacactggtgagaaaccacaCAAATGTGTTGTGTGTGATGAAACATTCTCACTTTCCTCAACCTTAACAAagcacatgaggactcacactggtgaaaaaccatacaaatgtacTGTGTGTGATAAATCGTTTTCACAATCCTCAAACTTAACATatcacatgaggactcacactggtgagaaaccgtATGAATGTGTTGAATGCGGTAAAATATTCTCCCTTTCCACGAGCTTAACGTtgcacatgaggactcacactggtgaaaagccgtACAAATgcgttgagtgtgataaaacattctccaAATCCTCAAATCTAAAGGAACACTTGAgggttcacactggtgagaaaccatacaaatgtgttgaatgtgataaaacattctctaAATCCTCAAATGTAAAAGatcacatgaggattcactGGCGAAAAAACATATGa
Protein Sequence: MYTYGKPYNCVECDKTFSQLSSLTYHMRTHTGEKPYKCVDCDEVFSLSSTLTKHMRTHTGERPYKCSECDKTFSQSSNLTFHMRTHTGEKPHKCVVCDETFSLSSTLTKHMRTHTGEKPYKCTVCDKSFSQSSNLTYHMRTHTGEKPYECVECGKIFSLSTSLTLHMRTHTGEKPYKCVECDKTFSKSSNLKEHLRVHTGEKPYKCVECDKTFSKSSNVKDHMRIHWRKNI

Sequence clustering based on sequence similarity using MMseqs2