Emi022931.1
Basic Information
- Insect
- Euclidia mi
- Gene Symbol
- -
- Assembly
- GCA_944738845.2
- Location
- CALYKX020000196.1:3372660-3382294[-]
Transcription Factor Domain
- TF Family
- zf-C2H2
- Domain
- zf-C2H2 domain
- PFAM
- PF00096
- TF Group
- Zinc-Coordinating Group
- Description
- The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 10 0.02 5.6 9.8 0.7 1 23 256 278 256 278 0.96 2 10 0.19 53 6.7 0.2 2 23 305 327 304 327 0.93 3 10 5.9e-05 0.017 17.7 0.2 1 23 350 372 350 372 0.98 4 10 3.6e-06 0.001 21.6 0.5 1 23 376 399 376 399 0.98 5 10 0.009 2.5 10.9 2.7 1 23 404 427 404 427 0.95 6 10 0.052 14 8.5 1.5 1 23 433 456 433 456 0.90 7 10 7.9e-08 2.2e-05 26.8 2.7 1 23 463 486 463 486 0.98 8 10 0.0014 0.38 13.4 3.8 1 23 492 514 492 514 0.97 9 10 5.4e-07 0.00015 24.2 1.0 1 23 520 542 520 542 0.99 10 10 7.6e-05 0.021 17.4 2.1 1 23 548 570 548 571 0.95
Sequence Information
- Coding Sequence
- ATGGATACAAATCataaaacaacatatggccagtgtcgctgctgtttagcaacaggacatcaccgagaattgaagaatgaatatttcttcaatggcataagagaagtctactatgaaattttcacagatatctttaatttattcCTCTCCACAAATCCTCACTTAACTACATTGATATGCACAACATGCATCCACCGGCTGCGAGATGCTACAAGCTTCCGCATGATGGTAGTGAGCACTGAGAAGCAGCTACTTGATTCACTTGTGAACAAGTCCAAACATGACAATGATGACACAGTTTATGTAGACATGCTAGTTGACGACGAGCCGCTTGACATGGGCGTGTCTGTGAAAGTGGAGTCTCAGGACGATGTGAAGGAAGAGAAAGATGAGTACCATCCAGTTACTGACAGTGGTGACTATGAGTCTGACATTGCTAATGACTACACGTCGGAAGATCAGTGCGAAGAGACAGTGCCGGGGGAGGCAGAGCTAATCTCTCGCTTCAAAAATGTGCCGCCGCTGCCCACCGGGGCGACCCTCCCAGACATCCTCCCAGATTACTGCAAGCATCTCTCTGTGCTCAGAAGTATAAAAGTCTATCCTCACATGATCGCGAAGTTAGTAGAGGACTTTGAAATCACAGAAGAGAATCGCACTGCTCGCCGTCTGTACGTCactgagaaactggcgcacatagtcaacacttcaaccattctagaatgttccaatgtcacgccgttcagaagcaaaagtcgacaaggattcccctgcttctactgcagaaatatcttcgaaaaccttgacaaactacaggaacacacctcagaacacaagaaaccagaaatgttaaaagtattgagaacttacggcgcagaatgcctagtcgtatacgtagatatcacagatctaagatgcaatttatgcaaacaaaatataccgagtctcaatgaactaaaattacatttaataaatattcacaagaagaaaatgcacctggatttcacagacagagttataccgttcaaactttccaacacgcctatgtatgaatgccaactgtgcggcttcagttttgaaacttttggcgccatcgaacgtcacatgaacgtccattttagaaactatgtttgtaaagactgcggcacaggcttcgtcacaagatacagattaaaagtgcacattaaaagtatgcatgcgggcggcacacatccttgcgaagtctgcggaaaaatattttccaccacacagaaacataagaaccatgtgaacaccgttcataagatgatgaagaggttcaaatgtacaaaatgccctgaacgtttcgctgagtatttcaggcgacagaaacacatggtacaagtccacggttttgctcctttgaagtacaaatgcaatgtttgtgacaagagttttgatagaaggtacacgctatcacggcatatgaagagagatcacttggaagagagagattatcaatgcgaaatgtgttcttacaaatgctttactaaaaacgagttgagagtgcatatggtaaagcacaatggtgaaagaatatacgaatgttctgtgtgtaagaaggcgtatgctcggaagaaaacgctgaaagaacatatgcgcatacacaataatgatagacgatttgcgtgcgcggtatgtggacaggcgtttgtgcagaagtgcagtctcaaaggtcacttgaagacccaccatcttgaattTAACTTACATTAA
- Protein Sequence
- MDTNHKTTYGQCRCCLATGHHRELKNEYFFNGIREVYYEIFTDIFNLFLSTNPHLTTLICTTCIHRLRDATSFRMMVVSTEKQLLDSLVNKSKHDNDDTVYVDMLVDDEPLDMGVSVKVESQDDVKEEKDEYHPVTDSGDYESDIANDYTSEDQCEETVPGEAELISRFKNVPPLPTGATLPDILPDYCKHLSVLRSIKVYPHMIAKLVEDFEITEENRTARRLYVTEKLAHIVNTSTILECSNVTPFRSKSRQGFPCFYCRNIFENLDKLQEHTSEHKKPEMLKVLRTYGAECLVVYVDITDLRCNLCKQNIPSLNELKLHLINIHKKKMHLDFTDRVIPFKLSNTPMYECQLCGFSFETFGAIERHMNVHFRNYVCKDCGTGFVTRYRLKVHIKSMHAGGTHPCEVCGKIFSTTQKHKNHVNTVHKMMKRFKCTKCPERFAEYFRRQKHMVQVHGFAPLKYKCNVCDKSFDRRYTLSRHMKRDHLEERDYQCEMCSYKCFTKNELRVHMVKHNGERIYECSVCKKAYARKKTLKEHMRIHNNDRRFACAVCGQAFVQKCSLKGHLKTHHLEFNLH
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00281658;
- 90% Identity
- iTF_00677938;
- 80% Identity
- -