Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 3.4 2.8e+03 -0.8 0.5 14 38 129 154 122 155 0.71

2 6 0.00052 0.43 11.4 2.0 13 40 156 180 149 187 0.83

3 6 0.0015 1.2 10.0 0.4 14 31 185 202 180 211 0.77

4 6 0.26 2.2e+02 2.7 0.6 19 38 218 238 214 242 0.86

5 6 5.6e-05 0.046 14.5 4.2 6 40 234 263 229 267 0.86

6 6 0.0015 1.2 9.9 0.7 18 33 272 288 266 295 0.76

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	3.4	2.8e+03	-0.8	0.5	14	38	129	154	122	155	0.71
2	6	0.00052	0.43	11.4	2.0	13	40	156	180	149	187	0.83
3	6	0.0015	1.2	10.0	0.4	14	31	185	202	180	211	0.77
4	6	0.26	2.2e+02	2.7	0.6	19	38	218	238	214	242	0.86
5	6	5.6e-05	0.046	14.5	4.2	6	40	234	263	229	267	0.86
6	6	0.0015	1.2	9.9	0.7	18	33	272	288	266	295	0.76

Coding Sequence: ATGAGTACTTCTGTGTGCAGAGTTTGTCTTGCCGGCGATATCAGAATGCACTGCATTGAAGATATCCAACTACTAGAAACATACGAAAAACTAACAAGTGTCAAGGTGACACACACAACGTTCAGCATGCTAAAGCTagacaacattaaaaatttgtcAGTAACACCTAGACAGTGCATGTCTATAGATTATAACTCGTACACCGGAAAAACTGTTGTAACTGATATGGAACAACAAGGAGTTTTGAAAGAAGAAATAACAGCTGAAGATAAAGGAATGATTGAAATTGGGAAGAGTGCAGTTGTAGATGATTATGAAAATGGTCATACATTCATAAAGGAACGGTCAATCGAAGGGAGCGTACACTTGCAAATGCACACCTACAATAAGAGTTACACCTGCAACAAACGTAAAAAAGAATTCAATCAAAAAAATGAATTGACAATACACATGCGAAATCACACTGCAGAGAAGCCGTACATATGCAACATATGTGGTAAGGCATTCAATAACAAAGCTAATTTGAGAATACACTTGCGAGTGCACTCCAGAAAACAGCCTAACGCCTGCAACATATGTGATAAAGCATTCAGTCGCAAAGGTAGTTTGGTAGTACACATGCGACTTCACACCGGAATTAAGCcctacgcctgcaacagatgtgataaggcattcaatcaaaaaGATAAATTGACAATACACATGCGAAATCACACTAGAGTGATGTACATATGCAACATATGTGGTAAGGCATTCAATAACAAAAGTAATTTGAGAGTACACTTGCGAATGCACACCAGAGTACAGCCTAACGCCTGCAACATATGTGATAAGGTATACAAACGAAAAGGGtttttgacaaaacacatgcaAATTCACACCAGAGAAACGCCACAGATGTGA
Protein Sequence: MSTSVCRVCLAGDIRMHCIEDIQLLETYEKLTSVKVTHTTFSMLKLDNIKNLSVTPRQCMSIDYNSYTGKTVVTDMEQQGVLKEEITAEDKGMIEIGKSAVVDDYENGHTFIKERSIEGSVHLQMHTYNKSYTCNKRKKEFNQKNELTIHMRNHTAEKPYICNICGKAFNNKANLRIHLRVHSRKQPNACNICDKAFSRKGSLVVHMRLHTGIKPYACNRCDKAFNQKDKLTIHMRNHTRVMYICNICGKAFNNKSNLRVHLRMHTRVQPNACNICDKVYKRKGFLTKHMQIHTRETPQM

Sequence clustering based on sequence similarity using MMseqs2