Ebru062199.1
Basic Information
- Insect
- Epinotia brunnichana
- Gene Symbol
- -
- Assembly
- GCA_963854355.1
- Location
- OY977960.1:6799251-6799811[-]
Transcription Factor Domain
- TF Family
- zf-GATA
- Domain
- zf-GATA domain
- PFAM
- PF00320
- TF Group
- Zinc-Coordinating Group
- Description
- This domain uses four cysteine residues to coordinate a zinc ion. This domain binds to DNA. Two GATA zinc fingers are found in the GATA transcription factors. However there are several proteins which only contain a single copy of the domain.
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 4 0.0021 17 7.1 0.1 22 33 14 25 3 27 0.80 2 4 0.0023 19 6.9 0.1 22 33 39 50 32 52 0.81 3 4 0.0023 19 6.9 0.1 22 33 64 75 57 77 0.81 4 4 0.0018 15 7.3 0.1 22 33 89 100 82 103 0.81
Sequence Information
- Coding Sequence
- ATGCGGCACATGCGGAGTCTGCACGACGCCAGGGTGTACATCTGCCGCGCCTGCGGGCTCGTGTTGAAGCGGCGCGACCATTACATCGCTCACTTAGGTCAGAGCCGGGTGTACATCTGCCGCGCCTGCGGGCTCGTGTTGAAGCGGCGCGACCATTACATCGCTCACTTAGGTCAGAGCCGGGTGTACATCTGCCGCGCCTGCGGGCTCGTGTTGAAGCGGCGCGACCATTACATCGCTCACTTAGGTCAGAGCCGGGTGTACATCTGCCGCGCCTGCGGGCTCGTGTTGAAGCGGCGCGACCATAACATCGCTCACTTAGGTCAGAGCCGGTACATTTGCATACATTACGAATGA
- Protein Sequence
- MRHMRSLHDARVYICRACGLVLKRRDHYIAHLGQSRVYICRACGLVLKRRDHYIAHLGQSRVYICRACGLVLKRRDHYIAHLGQSRVYICRACGLVLKRRDHNIAHLGQSRYICIHYE
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00657906;
- 90% Identity
- iTF_00657906;
- 80% Identity
- iTF_00657906;