Basic Information

Insect: Ectropis grisescens
Gene Symbol: -
Assembly: GCA_017562165.1
Location: chr12:7437261-7441079[-]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 10 0.02 1.1 9.8 4.2 1 23 27 50 27 50 0.98

2 10 4.1e-05 0.0023 18.3 2.0 1 23 56 78 56 78 0.98

3 10 0.00013 0.0072 16.8 0.2 1 23 84 106 84 106 0.99

4 10 0.0073 0.41 11.2 2.2 1 23 112 134 112 134 0.96

5 10 7.3e-06 0.00041 20.7 0.6 1 23 140 162 140 162 0.99

6 10 0.0052 0.29 11.7 4.0 1 23 168 190 168 191 0.94

7 10 1.4 80 4.0 2.0 1 23 197 220 197 220 0.86

8 10 1.6e-05 0.00093 19.6 1.9 1 23 225 247 225 247 0.98

9 10 2.7e-05 0.0015 18.9 0.3 1 23 253 275 253 275 0.99

10 10 0.0014 0.081 13.5 0.8 1 23 281 304 281 304 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	10	0.02	1.1	9.8	4.2	1	23	27	50	27	50	0.98
2	10	4.1e-05	0.0023	18.3	2.0	1	23	56	78	56	78	0.98
3	10	0.00013	0.0072	16.8	0.2	1	23	84	106	84	106	0.99
4	10	0.0073	0.41	11.2	2.2	1	23	112	134	112	134	0.96
5	10	7.3e-06	0.00041	20.7	0.6	1	23	140	162	140	162	0.99
6	10	0.0052	0.29	11.7	4.0	1	23	168	190	168	191	0.94
7	10	1.4	80	4.0	2.0	1	23	197	220	197	220	0.86
8	10	1.6e-05	0.00093	19.6	1.9	1	23	225	247	225	247	0.98
9	10	2.7e-05	0.0015	18.9	0.3	1	23	253	275	253	275	0.99
10	10	0.0014	0.081	13.5	0.8	1	23	281	304	281	304	0.97

Sequence Information

Coding Sequence: ATGGACGGAAATAAATGTACAACAGATGGCGGCTGCAAACGACAACGTCAAAAGAAAAAACGCAGTAACGAAATACCATACAAATGCGAGTTTtgcgaaaataaattgtttcaaaGCCACAGCGCGTTAAAACAGCACACCAGAACTCATACTGGCTACAAACCCCATAAATGTGGACAATGTGACGCAAAATTTGCTTTATCGAGCAATTTGTACCGGCATTTGAACAAACACAAAGGAATAAAACCATATGTTTGTGATCTATGCTCTGCTAAATTATCCACTAAAGTTGCACTAAAATTGCATTTACGAACACACACGGGCTTCAAACCGTACGAATGTACAGTTTGCGACTACAAATCGTCTCAAGAACATAAAGTAAAGCGACATAATTTGGTACATACGGGTGAGAAATCGTATGAGTGCAATTTATGTGACTCGAAATTCGCTCAACTCGGATATTTAAAGAACCATCAAAGAGTACACATGAGCGAAAAACCATTTGCCTGTAAATTGTGTCAATACAGATCAAACTTCGCGAGTAACTTAACGAGACATAATAAAAATCACCACACTGATGACAAACCATATAAATGTGATCAATGCGATTTTAAATCAGCAATTTTACACGTTCTAAACAGCCACCGCACACAAAAACATGGCGAAAAAAGATATGAATGCACGTTTTGCGATTACAAATCTTCTCTATCTAGTAATTTAAAACGGCATTTAAAGATCCATGCTGGAGAGAAAGCGTACAAATGTGAAATTTGCGATTACAGATCTGTTGACGGAAGCTATTTAGAAGTGCATCGAAGAACGCACACCGGCGAGAAACCGTATGAATGCAATATGTGCTCTTATAAAGGTACTGTAAAGAGTTTGTTGACAAATCACGTATTAAGAAAACACACTAACGAAAAGTCAAATATGCGAGTCGTCTGA
Protein Sequence: MDGNKCTTDGGCKRQRQKKKRSNEIPYKCEFCENKLFQSHSALKQHTRTHTGYKPHKCGQCDAKFALSSNLYRHLNKHKGIKPYVCDLCSAKLSTKVALKLHLRTHTGFKPYECTVCDYKSSQEHKVKRHNLVHTGEKSYECNLCDSKFAQLGYLKNHQRVHMSEKPFACKLCQYRSNFASNLTRHNKNHHTDDKPYKCDQCDFKSAILHVLNSHRTQKHGEKRYECTFCDYKSSLSSNLKRHLKIHAGEKAYKCEICDYRSVDGSYLEVHRRTHTGEKPYECNMCSYKGTVKSLLTNHVLRKHTNEKSNMRVV

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: -
90% Identity: -
80% Identity: -