Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 6.4e-07 0.0021 18.4 0.0 15 41 93 116 87 118 0.86

2 5 0.026 86 3.6 0.2 18 41 124 144 119 146 0.83

3 5 0.0036 12 6.4 0.8 5 38 140 173 136 173 0.80

4 5 3e-05 0.099 13.0 0.7 18 40 180 199 176 202 0.89

5 5 0.062 2e+02 2.4 1.2 18 40 208 227 200 229 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	6.4e-07	0.0021	18.4	0.0	15	41	93	116	87	118	0.86
2	5	0.026	86	3.6	0.2	18	41	124	144	119	146	0.83
3	5	0.0036	12	6.4	0.8	5	38	140	173	136	173	0.80
4	5	3e-05	0.099	13.0	0.7	18	40	180	199	176	202	0.89
5	5	0.062	2e+02	2.4	1.2	18	40	208	227	200	229	0.82

Coding Sequence: atgGTCCAGTGGAATCCAGGCCCGCAAGTCTCGACGCCGATCAATTACCAATCCGGGCTGCTGAGTCCCGGCTACACCGGAGCGACGTATTCGTTCACGGCGGACTttcgcccgcccccgcccgtcggcgagccggcgccggcgttcaAGGCGTtctcgccgtcctcgtcggcgtcgcacgccgcccgccgaaagccggcggcgcacgtcgcgcccgccTTCTAcgactccggcggcggcggcggcggcggcggcgacgcgttcgacgccgccgacaagCCGAACGTCTGCCGCATCTGCGGCAAGTCGTACGCCCGCCCCAGCACGCTCAAGACCCACCTGCGCACGCACAGCGGCGAGAAGCCCTACCGCTGCGCCGACTGCAACAAGTCCTTCTCGCAGGCGGCGAACCTCACCGCGCACGTGCGCACGCACAGCGGCGAGAAGCCCTTCCGGTGTCCGGTGTGCGACAGGCGCTTCTcgcagtcgtcgtcggtgaCGACGCACATGCGCACGCACAGCGGCGAGCGCCCTTATCGCTGCCGCCTCTGCAGGAAGGCCTTCTCCGACAGCAGCACGCTCACCAAGCACCTGCGCATCCACTCCGGCGAGAAGCCCTACGAGTGCAAGCTGTGCCTGCTGCGCTTCTCGCAGAGCGGCAACCTCAACCGGCACATGCGCGTGcacggcaacggcggcggcggcggcggcctcctTCCGCCATGA
Protein Sequence: MVQWNPGPQVSTPINYQSGLLSPGYTGATYSFTADFRPPPPVGEPAPAFKAFSPSSSASHAARRKPAAHVAPAFYDSGGGGGGGGDAFDAADKPNVCRICGKSYARPSTLKTHLRTHSGEKPYRCADCNKSFSQAANLTAHVRTHSGEKPFRCPVCDRRFSQSSSVTTHMRTHSGERPYRCRLCRKAFSDSSTLTKHLRIHSGEKPYECKLCLLRFSQSGNLNRHMRVHGNGGGGGGLLPP

Sequence clustering based on sequence similarity using MMseqs2