Basic Information

Transcription Factor Domain

TF Family: zf-BED
Domain: zf-BED domain
PFAM: PF02892
TF Group: Zinc-Coordinating Group
Description: The BED finger, which was named after the Drosophila proteins BEAF and DREF, is found in one or more copies in cellular regulatory factors and transposases from plants, animals and fungi. The BED finger is an about 50 to 60 amino acid residues domain that contains a characteristic motif with two highly conserved aromatic positions, as well as a shared pattern of cysteines and histidines that is predicted to form a zinc finger. As diverse BED fingers are able to bind DNA, it has been suggested that DNA-binding is the general function of this domain [3].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 1e-06 0.0036 17.8 0.1 17 41 94 115 88 117 0.89

2 5 0.026 93 3.7 0.2 18 41 123 143 118 145 0.83

3 5 0.0035 13 6.4 0.8 5 38 139 172 135 172 0.80

4 5 2.9e-05 0.11 13.1 0.7 18 40 179 198 175 201 0.89

5 5 0.06 2.2e+02 2.5 1.2 18 40 207 226 199 228 0.82

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	1e-06	0.0036	17.8	0.1	17	41	94	115	88	117	0.89
2	5	0.026	93	3.7	0.2	18	41	123	143	118	145	0.83
3	5	0.0035	13	6.4	0.8	5	38	139	172	135	172	0.80
4	5	2.9e-05	0.11	13.1	0.7	18	40	179	198	175	201	0.89
5	5	0.06	2.2e+02	2.5	1.2	18	40	207	226	199	228	0.82

Coding Sequence: GTCCAGTGGAATCCAGGGCCGCAGGTGTCGACCCCGATCAATTATCAATCCGGGCTGCTGAGTCCCGGCTACACCGGAGCGACGTACTCGTTCACGGCGGACTTCCGCCCGCCGCCGCCCGCCTGCGACCCGTCGCCGCCCTTCAAGGCGTTCTCGCCGTCCGCGTCGGCGTCGAACGCGCGCCGGAAAGCGGCCGCGCACGCTTTCTACGACGCCGCCGCCGACGCGAGCGGCGGCGCGTGCGGGGGCGGCGACGCGCCCGACGGCGGCGAGAAGCCGAACGTGTGCCGCATCTGCGGCAAGTCGTACGCGCGTCCCAGCACGCTCAAGACCCACCTGCGGACGCACAGCGGCGAAAAGCCCTATCGCTGCGCCGACTGCAACAAGTCCTTTTCGCAGGCGGCGAACCTCACCGCGCACGTGCGCACGCACAGCGGCGAGAAGCCCTTCCGGTGTCCGGTGTGCGACAGACGCTTCTCGCAGTCCTCGTCGGTGACGACGCACATGCGCACGCACAGCGGCGAGCGTCCGTACCGCTGCCGCCTCTGCAGGAAGGCCTTCTCCGACAGCAGCACGCTCACCAAGCACCTGCGCATTCACTCCGGCGAGAAGCCCTACGAGTGCAAGCTCTGCCTGCTGCGCTTCTCGCAGAGCGGCAATCTCAATCGGCACATGCGCGTGCACGGCAACGGTGGCGCGATGCCGCCATGA
Protein Sequence: VQWNPGPQVSTPINYQSGLLSPGYTGATYSFTADFRPPPPACDPSPPFKAFSPSASASNARRKAAAHAFYDAAADASGGACGGGDAPDGGEKPNVCRICGKSYARPSTLKTHLRTHSGEKPYRCADCNKSFSQAANLTAHVRTHSGEKPFRCPVCDRRFSQSSSVTTHMRTHSGERPYRCRLCRKAFSDSSTLTKHLRIHSGEKPYECKLCLLRFSQSGNLNRHMRVHGNGGAMPP

Sequence clustering based on sequence similarity using MMseqs2