Dtit045480.1
Basic Information
- Insect
- Dynastes tityus
- Gene Symbol
- NR2F2
- Assembly
- GCA_029618875.2
- Location
- JAROYD020000012.1:839217-843743[+]
Transcription Factor Domain
- TF Family
- RXR-like
- Domain
- zf-C4|RXR-like
- PFAM
- AnimalTFDB
- TF Group
- Zinc-Coordinating Group
- Description
- DNA-binding domain of retinoid X receptor (RXR) is composed of two C4-type zinc fingers. Each zinc finger contains a group of four Cys residues which co-ordinates a single zinc atom. RXR functions as a DNA binding partner by forming heterodimers with other nuclear receptors including CAR, FXR, LXR, PPAR, PXR, RAR, TR, and VDR. All RXR heterodimers preferentially bind response elements composed of direct repeats of two AGGTCA sites with a 1-5 bp spacer. RXRs can play different roles in these heterodimers. RXR acts either as a structural component of the heterodimer complex, required for DNA binding but not acting as a receptor, or as both a structural and a functional component of the heterodimer, allowing 9-cis RA to signal through the corresponding heterodimer. In addition, RXR can also form homodimers, functioning as a receptor for 9-cis RA, independently of other nuclear receptors. Like other members of the nuclear receptor (NR) superfamily of ligand-activated transcription factors, RXR has a central well conserved DNA binding domain (DBD), a variable N-terminal domain, a flexible hinge and a C-terminal ligand binding domain (LBD). [cite:PUB00121610], [cite:PUB00121611], [cite:PUB00121612], [cite:PUB00025660], [cite:PUB00121613], [cite:PUB00092048], [cite:PUB00092725], [cite:PUB00092726], [cite:PUB00016724], [cite:PUB00059514PMID:18971932
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 2 1.2 6.7e+03 -1.7 0.0 117 150 36 77 14 95 0.59 2 2 1.5e-34 9e-31 108.9 0.0 117 200 112 197 85 199 0.90
Sequence Information
- Coding Sequence
- ATGGTAGATACCGCATTAAGGGACAAATTTACGAGTGAAATTGAGCCAGGGAAAGTATTGGACCGTCTGTTTGCAGAATTAAGCGCGTTAACTTTCCGAAAGGCAATGGACATCGCTCAAATTACGGTATCTGCGCAAGTAAGTTATGGTGTTGCTAACGAAGTTCCTCCTTTGGTGAAGCAAGAAGACATTTCTATCCATCGTTTGGCGCAAGGTCAACATCATGGCAGACGCAAACGCAACACGAGGGGGAAGCTAGCCACCACAACGCCATCTACATCCACATCCGATTTCTCACATGGTCATCCCAAATATCGTAGGTGCGGAAGAGAAAATCATACAGATGCTTGCGGTCTCAGTGACGTGGCGCATATAGAGTCGATTCAAGAGAAATCGCAATGCGCCTTAGAAGAGTATTGCCGATCTCAGTATCCAAATCAGCCAACTAGATTCGGTAAGTTACTGCTGCGGTTACCAAGTCTGAGGACTGTCAGTTCAGCGGTGATAGAACAATTATTCTTCGTCCGGCTAGTAGGAAAAACACCAATAGAGACCCTAATTAGAGATATGCTACTGTCCGGAAGTTCGTTCTCTTGGCCATATATGTGA
- Protein Sequence
- MVDTALRDKFTSEIEPGKVLDRLFAELSALTFRKAMDIAQITVSAQVSYGVANEVPPLVKQEDISIHRLAQGQHHGRRKRNTRGKLATTTPSTSTSDFSHGHPKYRRCGRENHTDACGLSDVAHIESIQEKSQCALEEYCRSQYPNQPTRFGKLLLRLPSLRTVSSAVIEQLFFVRLVGKTPIETLIRDMLLSGSSFSWPYM
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00627333;
- 90% Identity
- iTF_00627333;
- 80% Identity
- iTF_00627333;