Basic Information

Insect: Drosophila willistoni
Gene Symbol: sug
Assembly: GCA_018902025.1
Location: JAFEWB010000695.1:3120396-3121566[+]

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 5 0.0017 0.14 12.9 0.0 1 23 115 140 115 140 0.92

2 5 4.5 3.7e+02 2.0 0.6 3 23 152 177 150 177 0.74

3 5 1.2e-07 1e-05 25.8 4.0 1 23 183 205 183 205 0.98

4 5 3.9e-05 0.0032 18.0 2.5 1 23 211 235 211 235 0.99

5 5 1e-05 0.00085 19.8 1.1 1 23 241 267 241 267 0.93

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	5	0.0017	0.14	12.9	0.0	1	23	115	140	115	140	0.92
2	5	4.5	3.7e+02	2.0	0.6	3	23	152	177	150	177	0.74
3	5	1.2e-07	1e-05	25.8	4.0	1	23	183	205	183	205	0.98
4	5	3.9e-05	0.0032	18.0	2.5	1	23	211	235	211	235	0.99
5	5	1e-05	0.00085	19.8	1.1	1	23	241	267	241	267	0.93

Sequence Information

Coding Sequence: ATGGATATTGTAGTACAAAAGTCAATGTCAATCTTCAACAGCTACGAGCCACCGGTGGGCTACTACACACCATATAATACACCGCCATATATAACACCCTATACGGAAAGCAGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNATTTCCCACACCACCAATAACACCGCCACGTCCGGTTCTCTTCGATGGTAACTCACCCACAGCGAATCTACGCACACAATCGGTCATTATGAAGGTGCAGAGTCCCAGCATAAGCATCAGTCCGGAGGAGGATAGCAATAGCAATAGCAGCAGCAGTGAATGCAGTGATTTCATATGCAATTGGCTGGAATGTGGACGAATCTTTGAGACACTTGAGGCGCTGGCTCAACATGTCACCCAGAGGCATGCCATAGCCTCGCTCAGTGATGGTCTCTACTATTGCCGCTGGCAAGGTTGCCAGCGTAGCGAACGGGGATTCAATGCCCGCTACAAGATGCTAGTACACACTCGTACCCATACCAAGGAGAAGCCACATCGGTGTCATCTATGTGAGAAATCATTCTCACGGGCGGAAAACCTCAAAATTCACATAAGATCGCATTCGGGTGAAAAGCCCTATAAATGCAATTTTGAGGGCTGCCAAAAGGCCTACTCCAATTCATCTGATCGCTTCAAACACACTCGCACCCACTCCATGGAGAAACCTTATATGTGCAAAGTAATTGGCTGCCAAAAACGTTATACAGATCCCTCATCATTGCGCAAACATGTGAAGACATTTAAGCATAGTATTCAATTGATTGCCAGTCAACCCTTGTCTTTGCCCAATCATCAGGCCATAGTCACCTCTCCGTCACCACTGGAGGCTAGCGAAGCCACCTACACCTGCCTCTTGCCCCCAGCACTGAGCGTTGAATCCTCATCATCATCGTACATGGATGCCACACAATCTAGTCCCGATGTGCCCAGCGATTATTCGTTAAAACATAAACCAACTACGGAATTCACATCCAGCTATTATCTACAAAGTGAGGACTACTATATGCATATGGATGGGGAAACGCCATTGGATCTAAGCATGCACAGAAGTTGA
Protein Sequence: MDIVVQKSMSIFNSYEPPVGYYTPYNTPPYITPYTESXXXXXXXXXXXXXXXXXXXXXFPTPPITPPRPVLFDGNSPTANLRTQSVIMKVQSPSISISPEEDSNSNSSSSECSDFICNWLECGRIFETLEALAQHVTQRHAIASLSDGLYYCRWQGCQRSERGFNARYKMLVHTRTHTKEKPHRCHLCEKSFSRAENLKIHIRSHSGEKPYKCNFEGCQKAYSNSSDRFKHTRTHSMEKPYMCKVIGCQKRYTDPSSLRKHVKTFKHSIQLIASQPLSLPNHQAIVTSPSPLEASEATYTCLLPPALSVESSSSSYMDATQSSPDVPSDYSLKHKPTTEFTSSYYLQSEDYYMHMDGETPLDLSMHRS

Similar Transcription Factors

Sequence clustering based on sequence similarity using MMseqs2

100% Identity: iTF_00604379;
90% Identity: iTF_00612356; iTF_00503540; iTF_00523993; iTF_00571470;
80% Identity: -