Dtsa002731.1
Basic Information
- Insect
- Drosophila tsacasi
- Gene Symbol
- CrebB_1
- Assembly
- GCA_018904565.1
- Location
- JAEIHY010003249.1:721-1758[-]
Transcription Factor Domain
- TF Family
- TF_bZIP
- Domain
- bZIP domain
- PFAM
- AnimalTFDB
- TF Group
- Basic Domians group
- Description
- bZIP proteins are homo- or heterodimers that contain highly basic DNA binding regions adjacent to regions of α-helix that fold together as coiled coils
- Hmmscan Out
-
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc 1 1 5.2e-17 6e-14 52.1 15.5 3 58 52 107 50 110 0.92
Sequence Information
- Coding Sequence
- ATGTCCGATGGCGTGCTCAACTCTCAGCTGGCGGGTAGCGGTGCGGGGGGCAATGCGACGAACAGCTCACTGATGCAGTTGGACCCGGCGTACTACCTGTCCAATCGGATGTCTTACAGCACCAACAATAGCGGGATAGCGGAGGATCAGACGCGCAAACGCGAGATCCGTCTGCAGAAGAACAGGGAGGCGGCGCGCGAGTGTCGGCGCAAGAAGAAGGAGTACATCAAGTGCCTGGAGAATCGCGTGGCGGTGCTAGAGAACCAAAACAAAGCGCTCATAGAGGAGCTCAAGTCGCTCAAGGAGCTCTACTGTCAGACCAAGAACGATTGA
- Protein Sequence
- MSDGVLNSQLAGSGAGGNATNSSLMQLDPAYYLSNRMSYSTNNSGIAEDQTRKREIRLQKNREAARECRRKKKEYIKCLENRVAVLENQNKALIEELKSLKELYCQTKND
Similar Transcription Factors
Sequence clustering based on sequence similarity using MMseqs2
- 100% Identity
- iTF_00488460;
- 90% Identity
- iTF_00488460;
- 80% Identity
- -