Basic Information

Transcription Factor Domain

TF Family: TEA
Domain: TEA domain
PFAM: PF01285
TF Group: Helix-turn-helix
Description: The TEA domain is a DNA-binding region of about 66 to 68 amino acids that has been named after the two proteins that originally defined the domain: TEF-1 and AbaA. The TEA domain is located toward the N terminus of eukaryotic transcription factors of the TEA/ATTS family. It shows a three-helix bundle with a homeodomain fold [3, 1]. Two α-helices are nearly anti-parallel and pack on either side of the third one, which is the DNA-recognition helix of the TEA domain. Phosphorylation of one or both of the two conserved serines found on the DNA-binding surface could interfere with DNA-binding activity, by introducing electrostatic repulsion and/or steric hindrance, and help regulate the transcription factor activity of the proteins [2, 1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 1 7.1e-11 6.4e-07 29.6 0.0 2 36 90 126 89 137 0.90

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	1	7.1e-11	6.4e-07	29.6	0.0	2	36	90	126	89	137	0.90

Coding Sequence: ATGAAAAACATTACCAGCTCAAGCACTTGCAGCACTGGCCTGCTGCAATTGCAGAACAATCTCAGCAGCAGCGAATTGGACGTTGTTGGCAAACCAGAGACGACGGCAGTTGGACCCGGCACCATACCATCTCCGTGGACACCAGTGAATGCCGGTCCTCCGGGTCCTCTGGGATCGGCGGACACAAATGGCAGCATGGTGGATAGTAAAAATTTGGATGTCGGCGATATGAGCGATGATGAAAAAGATTTATCATCTGCTGATGCCGAGGGTGTCTGGAGTCCAGACATCGAACAAAGCTTTCAAGAGGCCCTATCAATATATCCACCATGTGGACGCAGAAAAATCATATTATCCGATGAGGGTAAAATGTATGGTAAGTACACTTATACAATTGGATATCAAAGCCGTGTCCATAGCCATAGCCATGTCCATGTCCATGTCCGTGTCCATGTCCGTGTCCTCGACTATTATGTTGTTGCATGCATTGTGAAAGGGGCGTAG
Protein Sequence: MKNITSSSTCSTGLLQLQNNLSSSELDVVGKPETTAVGPGTIPSPWTPVNAGPPGPLGSADTNGSMVDSKNLDVGDMSDDEKDLSSADAEGVWSPDIEQSFQEALSIYPPCGRRKIILSDEGKMYGKYTYTIGYQSRVHSHSHVHVHVRVHVRVLDYYVVACIVKGA

Sequence clustering based on sequence similarity using MMseqs2