Dpic008282.1


Basic Information
Transcription Factor Domain
Sequence Information
Similer Transcription Factors

Basic Information

Insect
Drosophila picticornis
Gene Symbol
gcm
Assembly
GCA_035043845.1
Location
JAWNMR010000491.1:13527048-13528711[-]

Transcription Factor Domain

TF Family
GCM
Domain
GCM domain
PFAM
PF03615
TF Group
Beta-Scaffold Factors
Description
GCM transcription factors are a family of proteins which contain a GCM motif. The GCM motif is a domain that has been identified in proteins belonging to a family of transcriptional regulators involved in fundamental developmental processes which comprise Drosophila melanogaster GCM and its mammalian homologues [PMID: 8962155, PMID: 9114061, PMID: 9580683, PMID: 10671510]. IN GCM transcription factors the N-terminal moiety contains a DNA-binding domain of 150 residues. Sequence conservation is highest in this GCM domain. In contrast, the C-terminal moiety contains one or two transactivating regions and is only poorly conserved.The GCM motif has been shown to be a DNA binding domain that recognises preferentially the nonpalindromic octamer 5'-ATGCGGGT-3' [PMID: 8962155, PMID: 9114061, PMID: 9580683]. The GCM motif contains many conserved basic amino acid residues, seven cysteine residues, and four histidine residues [PMID: 8962155]. The conserved cysteines are involved in shaping the overall conformation of the domain, in the process of DNA binding and in the redox regulation of DNA binding [PMID: 9580683]. The GCM domain as a new class of Zn-containing DNA-binding domain with no similarity to any other DNA-binding domain [PMID: 12682016]. The GCM domain consists of a large and a small domain tethered together by one of the two Zn ions present in the structure. The large and the small domains comprise five- and three-stranded beta-sheets, respectively, with three small helical segments packed against the same side of the two beta-sheets. The GCM domain exercises a novel mode of sequence-specific DNA recognition, where the five-stranded beta-pleated sheet inserts into the major groove of the DNA. Residues protruding from the edge strand of the beta-pleated sheet and the following loop and strand contact the bases and backbone of both DNA strands, providing specificity for its DNA target site.
Hmmscan Out
# of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc
1 2 3.9e-79 3.2e-75 250.6 6.1 1 140 42 181 42 181 0.99
2 2 0.61 5e+03 -2.8 0.3 88 92 342 346 324 377 0.50

Sequence Information

Coding Sequence
ATGGTCTTGAACAGTCTGCGACCACTGTGTCAGCCGAGTCCGGCGCCAAGTCCGCCAGCGACCAAGTCTCGCATCCAAATCGAATGGGATATCAACGATACTGTGGTGCCGTCGGTCAGCGAATACGATGAGTTCAACGATTGGGCCAATGGCCATTGCCGCTTGATTTACGGGTCGCACAGTGAGGATGCCAAGAAGCATGCCAGTGGCTGGGCGATGCGCAACACCAACAATCACAATGTCAACATACTGAAGAAGAGCTGCCTGGGCGTCCTCCTCTGCAACGCCAAGTGCCGGCTGCCCAACGGCGCCAGCGTTCATCTGCGTCCCGCCATTTGTGACAAGGCACGGCGCAAACAGCAAGGCAAACAGTGCCCCAATAGGAACTGCAATGGACGCTTGGAGATACAGCCGTGCCGCGGTCACTGCGGCTATCCGGTCACCCACTTTTGGCGTCGTGCCGGCAACGCCATCTATTTCCAGGCAAAGGGCACACACGATCATGCCCGGCCGGAGGCGAAGGGTTCGACGGAGGCGCGTCGCTTGCTCGCCGGTGGCAGACGTGTCCGCAGTCTGGCAGTGATTCTCGCAAGAGATGCGGCGCTCAGCGATAAGTTGTGTAGCCTGAGAGCCAACAAGCGGCAGGCCAAGGCAGTTGGAGCCCAAGAGAACCCCACCAAGCGCAGCAAGCAACGCTCCACTAATGCGGATCAGCTGCTCCTGCAAGCCAGCACAGAGCTAACTGGCTATCAGAGTCCAAGCAGCAatccaccaacaacaacagcatcaccAACAGCTGCAGTCTTCAATCAGAGCCAGGCTCAGGCTACCTACCTTAATCCACAGTGGAGCACCATCGAATCCTACTATCCACCGGATGCCACATTGGGCTACACCACCAACATTTATGGCCACGATATGTTGCACTCGCCGCTCCCCTCCTCCAACAGCTCCACAGCCAGTTACTACAATGCCCACACagaagtgcaacagcaacaacagcaacaccaacagcagcaacaacagcaacaacaacagttgcaacaacaaccgctGCCCCAAGGCAACAACTATGaacagcaggcaacaacaggcACAACAACGACTACGTCCGGCTATCCGGCGAGTGGTAATCTTAAATACGAGAGCTGGGACGATACATCCAGCTTAACCAGTAGCTCAGGCTACAGCTCCGAGGACTATAGCTATTTCAATGGCTATGTGCCGCAGACTTTGGATATGAGTGGCAGCTCCAATGCCAGTCCCGAAGGCTTCTATACGCCACACTCGGAAATCTTTAATGTGTTTGATCCGAACATCAGTGGCACGGGTCCTTCTACAGTGGAGCTCTTGTACGATGAAGCCACtgcttatcagcagcagcagcagcagacgttgcaacagcagcagcaatcctTCCCCGTCTCctatcaacaacagcagcaacagcagcagcaaccacatcAGACcgctgattattattatagcaaCACGGGCGTGGATAACGTGTGGAATATTCAAATGGACGCGAGTGTGGCCACAGCTGCCTACCCAAGCACAAGCAGCCTGGTGGACTCTGGAGGCGTTGGTGTTTACTATTAA
Protein Sequence
MVLNSLRPLCQPSPAPSPPATKSRIQIEWDINDTVVPSVSEYDEFNDWANGHCRLIYGSHSEDAKKHASGWAMRNTNNHNVNILKKSCLGVLLCNAKCRLPNGASVHLRPAICDKARRKQQGKQCPNRNCNGRLEIQPCRGHCGYPVTHFWRRAGNAIYFQAKGTHDHARPEAKGSTEARRLLAGGRRVRSLAVILARDAALSDKLCSLRANKRQAKAVGAQENPTKRSKQRSTNADQLLLQASTELTGYQSPSSNPPTTTASPTAAVFNQSQAQATYLNPQWSTIESYYPPDATLGYTTNIYGHDMLHSPLPSSNSSTASYYNAHTEVQQQQQQHQQQQQQQQQQLQQQPLPQGNNYEQQATTGTTTTTSGYPASGNLKYESWDDTSSLTSSSGYSSEDYSYFNGYVPQTLDMSGSSNASPEGFYTPHSEIFNVFDPNISGTGPSTVELLYDEATAYQQQQQQTLQQQQQSFPVSYQQQQQQQQQPHQTADYYYSNTGVDNVWNIQMDASVATAAYPSTSSLVDSGGVGVYY