Basic Information

Transcription Factor Domain

TF Family: zf-C2H2
Domain: zf-C2H2 domain
PFAM: PF00096
TF Group: Zinc-Coordinating Group
Description: The C2H2 zinc finger is the classical zinc finger domain. The two conserved cysteines and histidines co-ordinate a zinc ion. The following pattern describes the zinc finger. #-X-C-X(1-5)-C-X3-#-X5-#-X2-H-X(3-6)-[H/C] Where X can be any amino acid, and numbers in brackets indicate the number of residues. The positions marked # are those that are important for the stable fold of the zinc finger. The final position can be either his or cys. The C2H2 zinc finger is composed of two short beta strands followed by an alpha helix. The amino terminal part of the helix binds the major groove in DNA binding zinc fingers. The accepted consensus binding sequence for Sp1 is usually defined by the asymmetric hexanucleotide core GGGCGG but this sequence does not include, among others, the GAG (=CTC) repeat that constitutes a high-affinity site for Sp1 binding to the wt1 promoter [1].
Hmmscan Out: # of c-Evalue i-Evalue score bias hmm coord from hmm coord to ali coord from ali coord to env coord from env coord to acc

1 6 1.1e-05 0.00068 19.6 2.2 2 23 116 137 116 137 0.97

2 6 1.2e-05 0.00073 19.5 5.8 1 23 143 165 143 165 0.98

3 6 2.1e-05 0.0013 18.6 5.0 2 23 173 194 172 194 0.97

4 6 0.00012 0.0074 16.3 1.3 3 23 202 223 200 223 0.96

5 6 0.00025 0.016 15.3 0.8 1 23 240 263 240 263 0.94

6 6 5.1e-06 0.00032 20.6 0.2 1 23 269 291 269 291 0.97

#	of	c-Evalue	i-Evalue	score	bias	hmm coord from	hmm coord to	ali coord from	ali coord to	env coord from	env coord to	acc
1	6	1.1e-05	0.00068	19.6	2.2	2	23	116	137	116	137	0.97
2	6	1.2e-05	0.00073	19.5	5.8	1	23	143	165	143	165	0.98
3	6	2.1e-05	0.0013	18.6	5.0	2	23	173	194	172	194	0.97
4	6	0.00012	0.0074	16.3	1.3	3	23	202	223	200	223	0.96
5	6	0.00025	0.016	15.3	0.8	1	23	240	263	240	263	0.94
6	6	5.1e-06	0.00032	20.6	0.2	1	23	269	291	269	291	0.97

Coding Sequence: ATGTTGAAAGTTGTAAACAATAGTAAAAAATGTGCAGAAATCTATTGCAACACATTAGTTCCGCCGACATACAACATTCTTTGCATATGTGGCAAATCTATTGATGAGTATTTATCATTTTGTGAGCATTTTTACAATGAACATTTGCTCAAACAACAAGATGTGGGAAATCAAGGAGATAAAGAGGAGGACGAAGATCAGACTCTCGAAACTGAAGTATGTCTTGAGGAACCACTGCTTGTGCTGCCCTCCTCTTCAGACAGTGAAGGCGACACGCTTACAGACAGCCAGGAGACGAGTTCGAGGCCAGAACGACGCGCTTACAAGGAACGCAATAAACCCAACACGTGCAGCTATTGTGGACGGATATTTAGACGCCGTCATCTGCTAGACACACACCTCAACATACACACGGGCCGCAAGCCGCATCAATGCCACAAGTGTGGCAAACAGTTTCGAGCCATCACCACATTGACGCGTCACTTGCGGACGCACGAAAAACGCCAGGAGCATCAACAATGTAAGCATTGCGACAAACAATTCACGCATCGCAGTGCTTTAGTTAGCCACGAGATGCGGCACACTCAGGTGCGTCGCTGGGCATGTAGCAGCTGCGATAAAAGCTTCTATACGCGCAATCAAATGGACACTCATCAACGCAAATTGCATGCTATGTTAGCTGAAGAGACTGCTGACAACGCCTCTGGTCACTTGCCTTTTTCTTGTGAGCTTTGTGGGAATAGTTATCGCAGCGCTTCCATGCTGAGCACGCATAAGTTAAATAAACACTATCGTTTGGCTAAATATGCTTGTGAGCAATGTGATAAGAAGTTTGTGGATGCTGAGCGCTTGCAGCAGCATCAACTAATTCATAAAAAGCCTGAAATCGTAATAAAATAA
Protein Sequence: MLKVVNNSKKCAEIYCNTLVPPTYNILCICGKSIDEYLSFCEHFYNEHLLKQQDVGNQGDKEEDEDQTLETEVCLEEPLLVLPSSSDSEGDTLTDSQETSSRPERRAYKERNKPNTCSYCGRIFRRRHLLDTHLNIHTGRKPHQCHKCGKQFRAITTLTRHLRTHEKRQEHQQCKHCDKQFTHRSALVSHEMRHTQVRRWACSSCDKSFYTRNQMDTHQRKLHAMLAEETADNASGHLPFSCELCGNSYRSASMLSTHKLNKHYRLAKYACEQCDKKFVDAERLQQHQLIHKKPEIVIK

Sequence clustering based on sequence similarity using MMseqs2